AusRegistry - .au Registry Provider

Official Domain Name Drop List

The Domain Name Drop List shows the date and time that Domain Names are eligible to be purged. When a Domain Name is purged, it becomes available for registration according to the policy of the Regulator. Unless restored the Domain Name will be purged at the next Purge Cycle, also as defined in Regulator Policy. The Purge Cycle is an automated process within the Domain Name Registry System.

Please note the date and time associated with the Domain Name are represented in Universal Coordinated Time (UTC).

This list was generated at 18:46:46 on 2014-09-02 UTC and contains all Domain Names identified for purging as at this time.

Expired Domain Names

This list shows Domain Names which have passed through the Expiry Process in the Domain Name Registry System and are eligible to be purged. These Domain Names generally cannot be recovered and will purge at the next cycle that occurs NO EARLIER THAN the date and time listed below.

DateEligible Purge TimeDomain Name
2014-09-0203:05:33mylittleowlhandmade.com.au
2014-09-0203:05:34envyusdigital.com.au
2014-09-0203:05:34fbwebdesign.com.au
2014-09-0203:05:34mailandparcelquote.com.au
2014-09-0203:05:34oscronrathdowne.com.au
2014-09-0203:05:34dreamylingerie.com.au
2014-09-0203:05:34directwebmarketing.com.au
2014-09-0203:05:35facewebdesign.com.au
2014-09-0203:05:35freezdrinks.com.au
2014-09-0203:05:35cheapgokarts.com.au
2014-09-0203:05:35webdesigngraphic.com.au
2014-09-0203:05:35mihsolutions.com.au
2014-09-0203:05:41postonline.net.au
2014-09-0203:15:31shopdvdmall.com.au
2014-09-0203:15:31goldcoastinternet.com.au
2014-09-0203:15:31blogstart.com.au
2014-09-0203:15:31fairylonglunch.com.au
2014-09-0203:15:31classicscooterrally.com.au
2014-09-0203:15:31customstickerprinting.com.au
2014-09-0203:15:31idealdvdmall.com.au
2014-09-0203:15:31woodwardspainting.com.au
2014-09-0203:15:31electricalrutherford.com.au
2014-09-0203:15:31glambydesign.com.au
2014-09-0203:15:31electricmotorrewinds.com.au
2014-09-0203:15:31getinsured.com.au
2014-09-0203:15:31chainsoflove.com.au
2014-09-0203:15:32farmfencing.com.au
2014-09-0203:15:32australiancomputerservices.com.au
2014-09-0203:15:32manitupnow.com.au
2014-09-0203:15:32colours88.com.au
2014-09-0203:15:32bargin.com.au
2014-09-0203:15:32blackwatermedia.com.au
2014-09-0203:15:32bellarineweddings.com.au
2014-09-0203:15:32bellarineweddingsandevents.com.au
2014-09-0203:15:32wrca.com.au
2014-09-0203:15:32knowledgeable.com.au
2014-09-0203:15:32simplebookkeeping.com.au
2014-09-0203:15:32rollupbanner.com.au
2014-09-0203:15:32creativejobs.com.au
2014-09-0203:15:32movingforward.com.au
2014-09-0203:15:33buildinghq.com.au
2014-09-0203:15:33lawyerhotline.com.au
2014-09-0203:15:33melbournefencingcontractors.com.au
2014-09-0203:15:33meetingroomsinsydney.com.au
2014-09-0203:15:33livingawayfromhomeallowance.com.au
2014-09-0203:15:33bellarineweddingplanner.com.au
2014-09-0203:15:38miriklis.net.au
2014-09-0203:15:38diysmsf.net.au
2014-09-0203:15:38southcoastaccommodation.net.au
2014-09-0203:15:38oe.net.au
2014-09-0203:15:38humanresources.net.au
2014-09-0203:15:38getinsurance.net.au
2014-09-0203:15:38gokarts.net.au
2014-09-0203:15:38retro.net.au
2014-09-0203:15:38best.net.au
2014-09-0203:25:32jdfurniture.com.au
2014-09-0203:25:32labeloffwine.com.au
2014-09-0203:25:33wateraeration.com.au
2014-09-0203:25:33powweb.com.au
2014-09-0203:25:33seanmurphyfloorandwalltiling.com.au
2014-09-0203:25:33tank-pump.com.au
2014-09-0203:25:33darwinevent.com.au
2014-09-0203:25:33majorvending.com.au
2014-09-0203:25:33enterprisedatainsights.com.au
2014-09-0203:25:33taikaj.com.au
2014-09-0203:25:33sump-pump.com.au
2014-09-0203:25:34showtimephotobooths.com.au
2014-09-0203:25:34retirementhelper.com.au
2014-09-0203:25:34healong.com.au
2014-09-0203:25:34water-fountain.com.au
2014-09-0203:25:34myretirementcoach.com.au
2014-09-0203:25:34peoplewealth.com.au
2014-09-0203:25:34waterirrigation.com.au
2014-09-0203:25:35bigpicturesigns.com.au
2014-09-0203:25:354x4challenge.com.au
2014-09-0203:25:35loveitlearnit.com.au
2014-09-0203:25:40made.net.au
2014-09-0203:25:40bigpicturesigns.net.au
2014-09-0203:25:41yell.org.au
2014-09-0203:35:30bore-pump.com.au
2014-09-0203:35:30pond-fountains.com.au
2014-09-0203:35:30outback4x4challenge.com.au
2014-09-0203:35:30emailfiltering.com.au
2014-09-0203:35:31highglosskitchens.com.au
2014-09-0203:35:31pressure-pump.com.au
2014-09-0203:35:31outback-challenge.com.au
2014-09-0203:35:31out-backchallenge.com.au
2014-09-0203:35:31bore-cleaning.com.au
2014-09-0203:35:31mlx.com.au
2014-09-0203:35:31submersible-pump.com.au
2014-09-0203:35:31vanguardcredit.com.au
2014-09-0203:35:31zevau.com.au
2014-09-0203:35:31zeroemissionvehicles.com.au
2014-09-0203:35:36meltingmoments.net.au
2014-09-0203:45:32morningtonmasala.com.au
2014-09-0203:45:32educationalproducts.com.au
2014-09-0203:45:32mistressmia.com.au
2014-09-0203:45:37relianceair.net.au
2014-09-0203:55:31regalexcavators.com.au
2014-09-0203:55:31temoraexies.com.au
2014-09-0203:55:31copperkingrecyclers.com.au
2014-09-0203:55:32educationproducts.com.au
2014-09-0203:55:32wizarddrivingschool.com.au
2014-09-0203:55:32wolfun.com.au
2014-09-0203:55:37enter.net.au
2014-09-0204:05:30nswfbr.com.au
2014-09-0204:05:30aceitcommunications.com.au
2014-09-0204:05:30emptytables.com.au
2014-09-0204:05:31dayofthechampions.com.au
2014-09-0204:05:31incontrolmedicalcentres.com.au
2014-09-0204:05:31appletreelogistics.com.au
2014-09-0204:05:36sebastianprogress.net.au
2014-09-0204:15:31bigfeatures.com.au
2014-09-0204:15:31mysportscommunity.com.au
2014-09-0204:15:31fionafenech.com.au
2014-09-0204:15:31mitchaustraliasidecarspeedwayframes.com.au
2014-09-0204:15:31logologo.com.au
2014-09-0204:15:31boxboat.com.au
2014-09-0204:15:31packingboxesaustralia.com.au
2014-09-0204:15:31baristaoncall.com.au
2014-09-0204:15:31hjchoice.com.au
2014-09-0204:15:36seavista.net.au
2014-09-0204:15:37bigfeatures.net.au
2014-09-0204:25:32ceomediagroup.com.au
2014-09-0204:25:32biglipmedia.com.au
2014-09-0204:25:32glenelgpodiatry-yellowpages.com.au
2014-09-0204:25:39sydneyqurancompetition.org.au
2014-09-0204:25:39sqc.org.au
2014-09-0204:35:31pick-a-partkawana.com.au
2014-09-0204:35:31pick-your-part.com.au
2014-09-0204:35:31pick-your-partgladstone.com.au
2014-09-0204:35:31pick-your-partrocky.com.au
2014-09-0204:35:31luvmachine.com.au
2014-09-0204:35:31pick-a-partrocky.com.au
2014-09-0204:35:31australianbusinessfocus.com.au
2014-09-0204:35:31pick-your-partmackay.com.au
2014-09-0204:35:31pick-a-partmackay.com.au
2014-09-0204:35:31pick-a-partgladstone.com.au
2014-09-0204:35:31pick-your-partrockhampton.com.au
2014-09-0204:35:32mobixpress.com.au
2014-09-0204:35:32pick-your-partkawana.com.au
2014-09-0204:35:32pick-a-partrockhampton.com.au
2014-09-0204:35:37mobixpress.net.au
2014-09-0204:45:31sanhevenstaffordshires.com.au
2014-09-0204:45:31trafficcontrolbrisbanecompanies.com.au
2014-09-0204:45:31getjdmparts.com.au
2014-09-0204:45:31gyozabar.com.au
2014-09-0204:45:32manymenus.com.au
2014-09-0204:45:32twofortyeight.com.au
2014-09-0204:45:32trafficcontrolcompanies.com.au
2014-09-0204:45:32carrentalbroome.com.au
2014-09-0204:45:32medicalwastedisposal.com.au
2014-09-0204:45:32geteuroparts.com.au
2014-09-0204:45:32trafficcontrolqld.com.au
2014-09-0204:45:32carrentalalicesprings.com.au
2014-09-0204:45:32iworms.com.au
2014-09-0204:45:32canvasprints-online.com.au
2014-09-0204:45:32saddleworldwagga.com.au
2014-09-0204:45:32executiveexpresssecretarial.com.au
2014-09-0204:45:32jcsshopndrop.com.au
2014-09-0204:45:32activegymnastics.com.au
2014-09-0204:45:33sydneyautospares.com.au
2014-09-0204:45:33agrivoicereserach.com.au
2014-09-0204:45:33grantjohnson.id.au
2014-09-0204:45:38opensydney.net.au
2014-09-0204:45:38saddleclub.net.au
2014-09-0204:45:39nwceac.org.au
2014-09-0204:45:39creatives.org.au
2014-09-0204:45:39brisbanemecfsfm.org.au
2014-09-0204:45:39orin.org.au
2014-09-0204:55:32wastemanagementvictoria.com.au
2014-09-0204:55:32creativeaccounts.com.au
2014-09-0204:55:32wastemanagementbrisbane.com.au
2014-09-0204:55:32medicalwastedisposalsydney.com.au
2014-09-0204:55:32realtradee.com.au
2014-09-0204:55:32zammitprojects.com.au
2014-09-0204:55:32liquidwastedisposalsydney.com.au
2014-09-0204:55:32socialseek.com.au
2014-09-0204:55:32renexconstructions.com.au
2014-09-0204:55:32flaniganconstructions.com.au
2014-09-0204:55:32medicalwastedisposalbrisbane.com.au
2014-09-0204:55:32clinicalwastedisposalsydney.com.au
2014-09-0204:55:32mondellscakeswerribee.com.au
2014-09-0204:55:32medicalwastedisposalmelbourne.com.au
2014-09-0204:55:32wastemanagementqueensland.com.au
2014-09-0204:55:32socialfirst.com.au
2014-09-0204:55:32socialinstinct.com.au
2014-09-0204:55:33altoopel.com.au
2014-09-0204:55:33melbournewastemanagement.com.au
2014-09-0204:55:33clinicalwastedisposalbrisbane.com.au
2014-09-0204:55:33cardboardrecyclingmelbounre.com.au
2014-09-0204:55:33thinkingpeoplehci.com.au
2014-09-0204:55:33clinicalwastedisposalmelbourne.com.au
2014-09-0204:55:33cardboardrecyclingsydney.com.au
2014-09-0204:55:33sanitaryservicemelbourne.com.au
2014-09-0204:55:33liquidwastedisposalmelbourne.com.au
2014-09-0204:55:33sanitaryservicesydney.com.au
2014-09-0204:55:33sydneywastemanagement.com.au
2014-09-0204:55:33unifiedcleaning.com.au
2014-09-0204:55:33cardboardrecyclingbrisbane.com.au
2014-09-0204:55:33sanitaryservicebrisbane.com.au
2014-09-0204:55:33clinicalwastedisposal.com.au
2014-09-0204:55:39gwq.org.au
2014-09-0205:05:31personalizedlollies.com.au
2014-09-0205:05:31saleszone.com.au
2014-09-0205:05:31gvbuyeradvocacy.com.au
2014-09-0205:05:31surfnstuff.com.au
2014-09-0205:05:31perthdrainage.com.au
2014-09-0205:05:32rockhamptonpainting.com.au
2014-09-0205:05:32nikeshoxshoes.com.au
2014-09-0205:05:32jodiesjourney.com.au
2014-09-0205:05:32carringtonfencing.com.au
2014-09-0205:05:32feralclothing.com.au
2014-09-0205:05:32mac-attack.com.au
2014-09-0205:05:32wastemanagementnewsouthwales.com.au
2014-09-0205:05:32ssufashion.com.au
2014-09-0205:05:32puma-shoes.com.au
2014-09-0205:05:32vvewines.com.au
2014-09-0205:05:32giftandboxit.com.au
2014-09-0205:05:32totalguttersolutions.com.au
2014-09-0205:05:32mgmbailey.com.au
2014-09-0205:05:32washroomservice.com.au
2014-09-0205:05:32jodysjourney.com.au
2014-09-0205:05:37southsidedemolition.net.au
2014-09-0205:05:37nikefreerun.net.au
2014-09-0205:15:31wildboys-shirts.com.au
2014-09-0205:15:31greatwinecapital.com.au
2014-09-0205:15:31isupplyaus.com.au
2014-09-0205:15:31sheppartonadvocacyservice.com.au
2014-09-0205:15:32sheppartonbuyeradvocacyservice.com.au
2014-09-0205:15:32nwmedreviews.com.au
2014-09-0205:15:32childsupportandfamilylaw.com.au
2014-09-0205:15:32rickcreative.com.au
2014-09-0205:15:32easymanagementgroup.com.au
2014-09-0205:15:32buysale.com.au
2014-09-0205:15:32iwantmysuperdone.com.au
2014-09-0205:15:324dcapital.com.au
2014-09-0205:15:32somethingforgrace.com.au
2014-09-0205:15:32sellsold.com.au
2014-09-0205:15:32myhomeloancomparison.com.au
2014-09-0205:15:32bidsale.com.au
2014-09-0205:15:32iwantmytaxdone.com.au
2014-09-0205:15:32swags-for-wags.com.au
2014-09-0205:15:32thefatgreek.com.au
2014-09-0205:15:32arrawatta.com.au
2014-09-0205:15:32sheppartonadvocacy.com.au
2014-09-0205:15:32climbcover.com.au
2014-09-0205:15:32iwantmybooksdone.com.au
2014-09-0205:15:33gvadvocacyservice.com.au
2014-09-0205:15:33keeponpainting.com.au
2014-09-0205:15:33buyandsale.com.au
2014-09-0205:15:33scorestudios.com.au
2014-09-0205:15:33thecornerpresents.com.au
2014-09-0205:15:33jonathanmarlow.com.au
2014-09-0205:15:33gravitasstudio.com.au
2014-09-0205:15:33nswdrugcharges.com.au
2014-09-0205:15:33sheppartonbuyeradvocacy.com.au
2014-09-0205:15:33youdoo.com.au
2014-09-0205:15:33gvbuyeradvocacyservice.com.au
2014-09-0205:15:33salesold.com.au
2014-09-0205:15:33mattyler.com.au
2014-09-0205:15:33digitalguide.com.au
2014-09-0205:15:33gvadvocacy.com.au
2014-09-0205:15:38thecornerpresents.net.au
2014-09-0205:15:38secondhandstuff.net.au
2014-09-0205:25:30fashionshotbylisalloyd.com.au
2014-09-0205:25:30kiss-make-up.com.au
2014-09-0205:25:30fastsolutionrealestate.com.au
2014-09-0205:25:30organicwineimports.com.au
2014-09-0205:25:30mibuy.com.au
2014-09-0205:25:30ednas.com.au
2014-09-0205:25:30robot-parts.com.au
2014-09-0205:25:31manningvalleyfirstaid.com.au
2014-09-0205:25:31appdat.com.au
2014-09-0205:25:31spendit.com.au
2014-09-0205:25:31brisgamers.com.au
2014-09-0205:25:31avantitreadmillrepairs.com.au
2014-09-0205:25:31australiasownchocolate.com.au
2014-09-0205:25:31rqplus.com.au
2014-09-0205:25:313rdagesolutions.com.au
2014-09-0205:25:31miningtrainingaustralia.com.au
2014-09-0205:25:31decma.com.au
2014-09-0205:25:31thirdagesolutions.com.au
2014-09-0205:25:31sickas.com.au
2014-09-0205:25:31souperb.com.au
2014-09-0205:25:31sucssa.com.au
2014-09-0205:25:31soundboundstudios.com.au
2014-09-0205:25:31morelloptics.com.au
2014-09-0205:25:31qld-drug-offences.com.au
2014-09-0205:25:31googlepenalty.com.au
2014-09-0205:25:31graceandjoy.com.au
2014-09-0205:25:37mybuy.net.au
2014-09-0205:25:37unifiedcleaning.net.au
2014-09-0205:25:37mibuy.net.au
2014-09-0205:35:31childrensetiquette.com.au
2014-09-0205:35:31farmersorganic.com.au
2014-09-0205:35:31travelexpendituremanagment.com.au
2014-09-0205:35:31etiquettetraining.com.au
2014-09-0205:35:31rsij.com.au
2014-09-0205:35:31teenetiquette.com.au
2014-09-0205:35:31superchutney.com.au
2014-09-0205:35:31rawim.com.au
2014-09-0205:35:32karenrobinson.com.au
2014-09-0205:35:32drearth.com.au
2014-09-0205:35:32etiquetteanddeportment.com.au
2014-09-0205:35:32miningskillspassport.com.au
2014-09-0205:35:32sampleanything.com.au
2014-09-0205:35:32mcelectrics.com.au
2014-09-0205:35:32childrenetiquette.com.au
2014-09-0205:35:32etiquetteforchildren.com.au
2014-09-0205:35:32etiquetteforteens.com.au
2014-09-0205:35:32teenageretiquette.com.au
2014-09-0205:35:32etiquetteacademy.com.au
2014-09-0205:35:32etiquettetrainers.com.au
2014-09-0205:35:32senradio.com.au
2014-09-0205:35:32deportmentandetiquette.com.au
2014-09-0205:35:37socialmediarealestate.net.au
2014-09-0205:35:37superchutney.net.au
2014-09-0205:35:38mysuperfund.org.au
2014-09-0205:45:00mysuperfund.asn.au
2014-09-0205:45:31billaturf.com.au
2014-09-0205:45:31marlowsappraisals.com.au
2014-09-0205:45:32luulka.com.au
2014-09-0205:45:32marlowspropertymanagement.com.au
2014-09-0205:45:32weddingflowersaustralia.com.au
2014-09-0205:45:32flyscreensyarravalley.com.au
2014-09-0205:45:32whittleconstruction.com.au
2014-09-0205:45:32aandjlocksmiths.com.au
2014-09-0205:45:32prestigefndtn-yellowpages.com.au
2014-09-0205:45:32transformu.com.au
2014-09-0205:45:32braddeboerelectricalservices.com.au
2014-09-0205:45:32mydresses.com.au
2014-09-0205:45:33virtualsymbiosis.com.au
2014-09-0205:45:38cornerpresents.net.au
2014-09-0205:55:32tnkroofing.com.au
2014-09-0205:55:32goldstarmining.com.au
2014-09-0205:55:32criticalfield.com.au
2014-09-0205:55:33cairnsfurnitureremovals.com.au
2014-09-0205:55:33youarethegap.com.au
2014-09-0205:55:33rentmygoods.com.au
2014-09-0205:55:33babyboomersandbellies.com.au
2014-09-0205:55:33cbdistillation.com.au
2014-09-0205:55:33drinkoz.com.au
2014-09-0205:55:33monoclesoftware.com.au
2014-09-0205:55:33thecreativestudio.com.au
2014-09-0205:55:33eurotrashgoddess.com.au
2014-09-0205:55:33hypoxibodycontourstudio.com.au
2014-09-0205:55:33sdlsports.com.au
2014-09-0205:55:33mackayfurnitureremovals.com.au
2014-09-0205:55:38chrismurphylawyers.net.au
2014-09-0205:55:38fastfriendships.net.au
2014-09-0206:05:32yogageelong.com.au
2014-09-0206:05:32idiscover.com.au
2014-09-0206:05:32mrmoustache.com.au
2014-09-0206:05:32mikenolaracing.com.au
2014-09-0206:05:32smartbuzz.com.au
2014-09-0206:05:32advanceddna.com.au
2014-09-0206:05:33thegreatcrepeescape.com.au
2014-09-0206:05:33oasisbuildhomes-yellowpages.com.au
2014-09-0206:05:33hoardfast.com.au
2014-09-0206:05:33rockhamptonfurnitureremovals.com.au
2014-09-0206:05:33inton.com.au
2014-09-0206:05:33melbourneman.com.au
2014-09-0206:05:33freightcentreaust.com.au
2014-09-0206:05:33aussiepaintballmilperra.com.au
2014-09-0206:05:33pumptune.com.au
2014-09-0206:05:33stimpack.com.au
2014-09-0206:05:33xecomedia.com.au
2014-09-0206:05:33martialartsgeelong.com.au
2014-09-0206:05:33nationalskills.com.au
2014-09-0206:05:33muaythaigeelong.com.au
2014-09-0206:05:33boxinggeelong.com.au
2014-09-0206:05:33feelgoodvalue.com.au
2014-09-0206:05:33justpay.com.au
2014-09-0206:05:33coloursalon.com.au
2014-09-0206:05:39karategeelong.net.au
2014-09-0206:05:39safesales.net.au
2014-09-0206:05:39stimpack.net.au
2014-09-0206:05:39aussiepaintballmilperra.net.au
2014-09-0206:05:39pumptune.net.au
2014-09-0206:05:40nbec.org.au
2014-09-0206:15:32hoofnpaw.com.au
2014-09-0206:15:32saltwatercreeksocialgolfclub.com.au
2014-09-0206:15:32a-forcetactical.com.au
2014-09-0206:15:32edsoncombe.com.au
2014-09-0206:15:32aforcetactical.com.au
2014-09-0206:15:32gandtsales.com.au
2014-09-0206:15:32seriousracing.com.au
2014-09-0206:15:32crownfitness.com.au
2014-09-0206:15:33arentchagettingfit.com.au
2014-09-0206:15:33divinerecords.com.au
2014-09-0206:15:33advanceddnalabs.com.au
2014-09-0206:15:33forcetactical.com.au
2014-09-0206:15:33imcasual.com.au
2014-09-0206:15:33acearborsydney.com.au
2014-09-0206:15:33changinghomes.com.au
2014-09-0206:15:38forcetactical.net.au
2014-09-0206:15:38discoveraustralia.net.au
2014-09-0206:15:38aforcetactical.net.au
2014-09-0206:15:38a-forcetactical.net.au
2014-09-0206:15:38idiscover.net.au
2014-09-0206:15:38openhomes.net.au
2014-09-0206:15:39digifone.net.au
2014-09-0206:25:31fluidchillaustralia.com.au
2014-09-0206:25:31fluidchill.com.au
2014-09-0206:25:31melbournesupport.com.au
2014-09-0206:25:31ozziesale.com.au
2014-09-0206:25:31exmouthfishing.com.au
2014-09-0206:25:31ozibuy.com.au
2014-09-0206:25:31renorepairplastering.com.au
2014-09-0206:25:31exmouthcharters.com.au
2014-09-0206:25:31dukandietshop.com.au
2014-09-0206:25:31rustyborestainsremoval.com.au
2014-09-0206:25:32staffhunter.com.au
2014-09-0206:25:32employerwanted.com.au
2014-09-0206:25:32learnerapproved.com.au
2014-09-0206:25:32enlaw.com.au
2014-09-0206:25:32badabingbadaboom.com.au
2014-09-0206:25:32exmouthfishingcharters.com.au
2014-09-0206:25:32lepetitcake.com.au
2014-09-0206:25:32sydneyheatingandcoolingservices.com.au
2014-09-0206:25:32auzibuy.com.au
2014-09-0206:25:32simprotraining.com.au
2014-09-0206:25:322yellowdots.com.au
2014-09-0206:25:37tracking.net.au
2014-09-0206:25:37jacksonmay.net.au
2014-09-0206:35:31websiteproductionwarehouse.com.au
2014-09-0206:35:31slatebusinesservices.com.au
2014-09-0206:35:31lifeinsurance4me.com.au
2014-09-0206:35:31wpwarehouse.com.au
2014-09-0206:35:31breastlift-melbourne.com.au
2014-09-0206:35:31abpoa.com.au
2014-09-0206:35:31identifire.com.au
2014-09-0206:35:31vogueexecutiveescorts.com.au
2014-09-0206:35:31cosmeticsassys.com.au
2014-09-0206:35:31bedroomtoboardroom.com.au
2014-09-0206:35:32therover.com.au
2014-09-0206:35:32furnitureremovalscoffsharbour.com.au
2014-09-0206:35:32netsmith.com.au
2014-09-0206:35:37superiorseal.net.au
2014-09-0206:45:32carelifeministries.com.au
2014-09-0206:45:32deliverydo.com.au
2014-09-0206:45:32d-a-g.com.au
2014-09-0206:45:32stickysouls.com.au
2014-09-0206:45:32wheels2you.com.au
2014-09-0206:45:32digesteasy.com.au
2014-09-0206:45:32henningsandco.com.au
2014-09-0206:45:32townsvillefurnitureremovals.com.au
2014-09-0206:45:33dailyrituals.com.au
2014-09-0206:45:33perthairportdutyfree.com.au
2014-09-0206:45:33peachtreerestorations.com.au
2014-09-0206:45:33stonescornerhairsalons.com.au
2014-09-0206:45:33ptrestorations.com.au
2014-09-0206:45:33incomeprotection4me.com.au
2014-09-0206:45:33askangela.com.au
2014-09-0206:45:38furnitureremovalscoffsharbour.net.au
2014-09-0206:45:38lifeinsurance4me.net.au
2014-09-0206:45:39activegymnastics.org.au
2014-09-0206:55:30deskwarecomputingsolutions.com.au
2014-09-0206:55:31helpmeretire.com.au
2014-09-0206:55:31realestatebundall.com.au
2014-09-0206:55:31dopex.com.au
2014-09-0206:55:31superoof.com.au
2014-09-0206:55:31completecure.com.au
2014-09-0206:55:31decorativeliving.com.au
2014-09-0206:55:31precisepredictions.com.au
2014-09-0206:55:32batteriesforcar.com.au
2014-09-0206:55:32essentialinsanities.com.au
2014-09-0206:55:3230secondvps.com.au
2014-09-0206:55:32direct-ps.com.au
2014-09-0206:55:32bfcarbrokers.com.au
2014-09-0207:05:31hooked-australia.com.au
2014-09-0207:05:32safemind.com.au
2014-09-0207:05:32revenuepluss.com.au
2014-09-0207:05:32cashortradeit.com.au
2014-09-0207:05:32sparkysafe.com.au
2014-09-0207:05:32michellestarpersonaltrainer.com.au
2014-09-0207:05:32marineenginespares.com.au
2014-09-0207:05:32semosrestaurant.com.au
2014-09-0207:05:32triple11.com.au
2014-09-0207:05:32bytemasons.com.au
2014-09-0207:05:32buildersafe.com.au
2014-09-0207:05:32lecil.com.au
2014-09-0207:05:32kangarooislandqualityhomes.com.au
2014-09-0207:05:32kitchensofexcellence.com.au
2014-09-0207:05:32plumsafe.com.au
2014-09-0207:05:32beehiveclub.com.au
2014-09-0207:05:32traffsafe.com.au
2014-09-0207:05:33gardinerlandscapes.com.au
2014-09-0207:05:33ade.id.au
2014-09-0207:05:33savetheswanvalley.com.au
2014-09-0207:05:39all4one.org.au
2014-09-0207:15:3265000spiders.com.au
2014-09-0207:15:32vividwebsitehostinggoldcoast.com.au
2014-09-0207:15:32vividbannerdesign.com.au
2014-09-0207:15:32joinkinselas.com.au
2014-09-0207:15:32runningontime.com.au
2014-09-0207:15:32vividgraphicdesigngoldcoast.com.au
2014-09-0207:15:32vividpullupbanners.com.au
2014-09-0207:15:32vividwebsitedevelopment.com.au
2014-09-0207:15:321300lawnsz.com.au
2014-09-0207:15:32vividofficeprinting.com.au
2014-09-0207:15:32vivid-graphicdesign.com.au
2014-09-0207:15:32vividdomainhosting.com.au
2014-09-0207:15:32vividwebsitedevelopersgoldcoast.com.au
2014-09-0207:15:32northshorehospitalflorist.com.au
2014-09-0207:15:32vividwebsitehosting.com.au
2014-09-0207:15:33vividwebsitedeveloper.com.au
2014-09-0207:15:33vividbusinesscards.com.au
2014-09-0207:15:33zoe-madison.com.au
2014-09-0207:15:33vividaframes.com.au
2014-09-0207:15:33vividbusinesscarddesign.com.au
2014-09-0207:15:33australianindigenousart.com.au
2014-09-0207:15:33wellandable.com.au
2014-09-0207:15:33checkappointment.com.au
2014-09-0207:15:33vividdomainhostinggoldcoast.com.au
2014-09-0207:15:33vividtradeprinting.com.au
2014-09-0207:15:33pittwatercounselling.com.au
2014-09-0207:15:33northshoreprivatehospitalflorist.com.au
2014-09-0207:15:33vividwebdeveloper.com.au
2014-09-0207:15:33theoldstthomaschapel.com.au
2014-09-0207:15:33yourbookings.com.au
2014-09-0207:15:33nellies.com.au
2014-09-0207:15:33vividlogodesign.com.au
2014-09-0207:15:33appointmentcheck.com.au
2014-09-0207:15:33vividwebsitedevelopers.com.au
2014-09-0207:15:33clementinajewellery.com.au
2014-09-0207:15:34vividwebdesigner.com.au
2014-09-0207:15:34vividwebdesigners.com.au
2014-09-0207:15:34vividwindflags.com.au
2014-09-0207:15:34vividwebsitedesigner.com.au
2014-09-0207:15:34hfproducts.com.au
2014-09-0207:15:34tipotiart.com.au
2014-09-0207:15:34vivid-banners.com.au
2014-09-0207:15:34vividwebdevelopers.com.au
2014-09-0207:15:34torres-strait-art.com.au
2014-09-0207:15:34vividwebsitedesigners.com.au
2014-09-0207:15:34vividwebsitedevelopergoldcoast.com.au
2014-09-0207:15:34vividwebdevelopment.com.au
2014-09-0207:15:34zoemadison.com.au
2014-09-0207:15:34vividstationeryprinting.com.au
2014-09-0207:15:34vivid-webdesign.com.au
2014-09-0207:15:34vividlogodesigngoldcoast.com.au
2014-09-0207:15:34tipoti.com.au
2014-09-0207:15:39custompccase.net.au
2014-09-0207:25:31vividpullupbannersgoldcoast.com.au
2014-09-0207:25:31vividbusinesscardsgoldcoast.com.au
2014-09-0207:25:31vividwebsitedesignersgoldcoast.com.au
2014-09-0207:25:31vividwebdesignersgoldcoast.com.au
2014-09-0207:25:31cloudsauce.com.au
2014-09-0207:25:31katesuttonmillinery.com.au
2014-09-0207:25:31kobelcoconstruction.com.au
2014-09-0207:25:31thetester.com.au
2014-09-0207:25:31heddon.com.au
2014-09-0207:25:32vividbusinesscarddesigngoldcoast.com.au
2014-09-0207:25:32taspanotour.com.au
2014-09-0207:25:32unitfactoryoutlet.com.au
2014-09-0207:25:32emtworkforce.com.au
2014-09-0207:25:32vividwindflagsgoldcoast.com.au
2014-09-0207:25:32vividaframesgoldcoast.com.au
2014-09-0207:25:32pro-enviro.com.au
2014-09-0207:25:32vividwebdevelopersgoldcoast.com.au
2014-09-0207:25:32vividwebdevelopmentgoldcoast.com.au
2014-09-0207:25:32backseattravel.com.au
2014-09-0207:25:32moneybook.com.au
2014-09-0207:25:32vividsocialmedia.com.au
2014-09-0207:25:32southernpropertydesigns.com.au
2014-09-0207:25:32vividbowbannersgoldcoast.com.au
2014-09-0207:25:32vividseogoldcoast.com.au
2014-09-0207:25:33thepharmacynetwork.com.au
2014-09-0207:25:33proenviro.com.au
2014-09-0207:25:33vividsocialmediagoldcoast.com.au
2014-09-0207:25:33vividstationeryprintinggoldcoast.com.au
2014-09-0207:25:33vividwebdesigngoldcoast.com.au
2014-09-0207:25:33vividreputationmanagement.com.au
2014-09-0207:25:33vividreputationmanagementgoldcoast.com.au
2014-09-0207:25:33vividwebsitedesign.com.au
2014-09-0207:25:33vividbannersgoldcoast.com.au
2014-09-0207:25:33vividwebdevelopergoldcoast.com.au
2014-09-0207:25:33kriscendostudios.com.au
2014-09-0207:25:33emtstaff.com.au
2014-09-0207:25:33drpope.com.au
2014-09-0207:25:33vividofficeprintinggoldcoast.com.au
2014-09-0207:25:33vividtradeprintinggoldcoast.com.au
2014-09-0207:25:33vividseo.com.au
2014-09-0207:25:33vividbannerdesigngoldcoast.com.au
2014-09-0207:25:33allforonesies.com.au
2014-09-0207:25:33highwalldewatering.com.au
2014-09-0207:25:34beforethebellchildcare.com.au
2014-09-0207:25:34vividwebsitedesigngoldcoast.com.au
2014-09-0207:25:34vividwebsitedevelopmentgoldcoast.com.au
2014-09-0207:25:34vividwebdesignergoldcoast.com.au
2014-09-0207:25:34minedewatering.com.au
2014-09-0207:25:34drraoulpope.com.au
2014-09-0207:25:34vividwebsitedesignergoldcoast.com.au
2014-09-0207:25:34nick-scali.com.au
2014-09-0207:25:34raoulpope.com.au
2014-09-0207:25:34sculpttrainingcentre.com.au
2014-09-0207:25:34soft-engine.com.au
2014-09-0207:25:34vividbowbanners.com.au
2014-09-0207:25:39pro-enviro.net.au
2014-09-0207:25:39proenviro.net.au
2014-09-0207:25:39nitevision.net.au
2014-09-0207:25:39gardinerlandscapes.net.au
2014-09-0207:25:39kobelcoaustralia.net.au
2014-09-0207:35:31nakhla.com.au
2014-09-0207:35:31shakeitbrisbane.com.au
2014-09-0207:35:31mscd2.com.au
2014-09-0207:35:31prdeals.com.au
2014-09-0207:35:31kobelcoaustralia.com.au
2014-09-0207:35:31greatweddingideas.com.au
2014-09-0207:35:31welovearmidale.com.au
2014-09-0207:35:31emtrecruit.com.au
2014-09-0207:35:31emtrecruitment.com.au
2014-09-0207:35:31vividfashions.com.au
2014-09-0207:35:31kobelconsw.com.au
2014-09-0207:35:31milkphotography1.com.au
2014-09-0207:35:31cpapwholesale.com.au
2014-09-0207:35:31reinasu.com.au
2014-09-0207:35:31crackedyouridevice.com.au
2014-09-0207:35:32carsright.com.au
2014-09-0207:35:32butterfly-impressions.com.au
2014-09-0207:35:37backseattravel.net.au
2014-09-0207:45:32airporttransfer-victoriahirecar.com.au
2014-09-0207:45:32virtualtourservice.com.au
2014-09-0207:45:32misc-projects.com.au
2014-09-0207:45:32gospelofgrace.com.au
2014-09-0207:45:32refreshfragrances.com.au
2014-09-0207:45:32cablingservice.com.au
2014-09-0207:45:32grouphuggle.com.au
2014-09-0207:45:32broilerhouse.com.au
2014-09-0207:45:32cablers.com.au
2014-09-0207:45:32virtualtourservices.com.au
2014-09-0207:45:33virtualdebitcards.com.au
2014-09-0207:45:33graceofgod.com.au
2014-09-0207:45:33refreshfragrancescosmetics.com.au
2014-09-0207:45:33arrcom.com.au
2014-09-0207:45:33virtualdebitcard.com.au
2014-09-0207:45:33ncrhub1.com.au
2014-09-0207:45:33australianroadexpress.com.au
2014-09-0207:45:33spillway.com.au
2014-09-0207:45:33legitimutt.com.au
2014-09-0207:45:33refreshcosmetics.com.au
2014-09-0207:45:38refreshcosmetics.net.au
2014-09-0207:45:38wondershop.net.au
2014-09-0207:45:38construk.net.au
2014-09-0207:55:31distanthurst.com.au
2014-09-0207:55:31bymus.com.au
2014-09-0207:55:31shiznizzle.com.au
2014-09-0207:55:31wiffy.com.au
2014-09-0207:55:31systemsonline.com.au
2014-09-0207:55:31snizzi.com.au
2014-09-0207:55:32coolsales.com.au
2014-09-0207:55:32fishinglog.com.au
2014-09-0207:55:32pabxonline.com.au
2014-09-0207:55:32lifeslittlejourney.com.au
2014-09-0207:55:32ceymplon.com.au
2014-09-0207:55:37shiznizzle.net.au
2014-09-0208:05:31gogotoners.com.au
2014-09-0208:05:31footyhoody.com.au
2014-09-0208:05:31footyhoodyz.com.au
2014-09-0208:05:31legend-travel-insurance.com.au
2014-09-0208:05:31footyhoods.com.au
2014-09-0208:05:31pymwymi.com.au
2014-09-0208:05:31footyhoodys.com.au
2014-09-0208:05:31footyhoodies.com.au
2014-09-0208:05:32accessdrivingschool.com.au
2014-09-0208:05:32interprisesolutions.com.au
2014-09-0208:05:32discountedtravel.com.au
2014-09-0208:05:32usi-aust.com.au
2014-09-0208:05:32foodyhoodz.com.au
2014-09-0208:05:32chainsacc.com.au
2014-09-0208:05:37revolutiongroup.net.au
2014-09-0208:15:30clover-creative.com.au
2014-09-0208:15:31hypnotherapysuccess.com.au
2014-09-0208:15:31realestateraffle.com.au
2014-09-0208:15:31behearing.com.au
2014-09-0208:15:31lakesiderentals.com.au
2014-09-0208:15:31thesocialmarketplace.com.au
2014-09-0208:15:31freecourtesycar.com.au
2014-09-0208:15:31bankwesthqinvite.com.au
2014-09-0208:15:31mmjcanberra.com.au
2014-09-0208:15:31socialmarketplace.com.au
2014-09-0208:15:31freedomhypnotherapy.com.au
2014-09-0208:15:31wildgardens.com.au
2014-09-0208:15:31thecladdingstore.com.au
2014-09-0208:15:31cogstackconsulting.com.au
2014-09-0208:15:31ericksonianhypnotherapy.com.au
2014-09-0208:15:31onejourneyonefuture.com.au
2014-09-0208:15:31joslawnmowing.com.au
2014-09-0208:15:31gdigaragedoors.com.au
2014-09-0208:15:32omninaturalhealth.com.au
2014-09-0208:15:32thesweetestthingevents.com.au
2014-09-0208:15:32ultimatefry.com.au
2014-09-0208:15:32insulateddoorsaustralia.com.au
2014-09-0208:15:37behearing.net.au
2014-09-0208:15:38hibiscus.org.au
2014-09-0208:25:30arcadeeditors.com.au
2014-09-0208:25:30classicbalastrade.com.au
2014-09-0208:25:31solarpanelcleaningman.com.au
2014-09-0208:25:31solarpanelcleaningguy.com.au
2014-09-0208:25:31australianonline.com.au
2014-09-0208:25:31masteryourmindset.com.au
2014-09-0208:25:31minimoke.com.au
2014-09-0208:25:31gorilla-inc.com.au
2014-09-0208:25:31wildscience.com.au
2014-09-0208:25:31teklinkaustralia.com.au
2014-09-0208:25:31truehorizon.com.au
2014-09-0208:25:31lytz.com.au
2014-09-0208:25:31teklinkaus.com.au
2014-09-0208:25:31kindermusikwithmarina.com.au
2014-09-0208:25:31thatsnotdinner.com.au
2014-09-0208:25:31shinetimechildcare.com.au
2014-09-0208:35:30tradingforwealth.com.au
2014-09-0208:35:30thepropertylawyer.com.au
2014-09-0208:35:30telephonemanual.com.au
2014-09-0208:35:30myboobiesnow.com.au
2014-09-0208:35:30ctcresumes.com.au
2014-09-0208:35:31investingforwealth.com.au
2014-09-0208:35:31pantherden.com.au
2014-09-0208:35:31incrowd.com.au
2014-09-0208:35:31ecommerceandwebdesign.com.au
2014-09-0208:35:31broadbandsales.com.au
2014-09-0208:35:31study-hospitality.com.au
2014-09-0208:35:31mini-digger-hire.com.au
2014-09-0208:35:31rentalsmackay.com.au
2014-09-0208:35:31onepenny.com.au
2014-09-0208:35:31allaboutgardens.com.au
2014-09-0208:35:32bathurstlatticeandlumber.com.au
2014-09-0208:35:37secondhandcars.net.au
2014-09-0208:35:37dongas.net.au
2014-09-0208:45:31opalinteriors.com.au
2014-09-0208:45:31hoardinggoldcoast.com.au
2014-09-0208:45:31vidsquid.com.au
2014-09-0208:45:31indentiguard.com.au
2014-09-0208:45:31melbournesmilestudio.com.au
2014-09-0208:45:31mywordoftheday.com.au
2014-09-0208:45:31hoardingbrisbane.com.au
2014-09-0208:45:31cogstacks.com.au
2014-09-0208:45:31beachshackbuys.com.au
2014-09-0208:45:31digitalcockpit.com.au
2014-09-0208:45:31tiarne.com.au
2014-09-0208:45:32verbatimtheatre.com.au
2014-09-0208:45:37prmcbride.net.au
2014-09-0208:45:37workmoves.net.au
2014-09-0208:45:37space-works.net.au
2014-09-0208:55:32gamerslounge.com.au
2014-09-0208:55:32sugarshacklollies.com.au
2014-09-0208:55:32dinnerwithathousandstars.com.au
2014-09-0208:55:32a11.com.au
2014-09-0208:55:32schoolgovernanceblog.com.au
2014-09-0208:55:32jtst.com.au
2014-09-0208:55:32a13.com.au
2014-09-0208:55:32waterzoom.com.au
2014-09-0208:55:32suagrshackcandy.com.au
2014-09-0208:55:32ceramicore.com.au
2014-09-0208:55:32healthforge.com.au
2014-09-0208:55:32snapandgrip.com.au
2014-09-0208:55:37zingle.net.au
2014-09-0209:05:31blogitup.com.au
2014-09-0209:05:31transformerfitness.com.au
2014-09-0209:05:31forall.com.au
2014-09-0209:05:31hansonshydraulics.com.au
2014-09-0209:05:37waddington.net.au
2014-09-0209:15:31myezytoll.com.au
2014-09-0209:15:31pureindulgencebeauty.com.au
2014-09-0209:15:32eatadvisor.com.au
2014-09-0209:15:32gominingaustralia.com.au
2014-09-0209:15:32completecontacts.com.au
2014-09-0209:15:32yourweather.com.au
2014-09-0209:15:32jtconveyancing.com.au
2014-09-0209:15:32excelatek.com.au
2014-09-0209:15:32purplepeoplecleaners.com.au
2014-09-0209:15:32virtuellebyts.com.au
2014-09-0209:15:32gardenstatefruit.com.au
2014-09-0209:15:32buyweatherstations.com.au
2014-09-0209:15:32gunnonline.com.au
2014-09-0209:25:31sustainableliving4you.com.au
2014-09-0209:25:31specialtyautomotive.com.au
2014-09-0209:25:31therapidchangeworkshop.com.au
2014-09-0209:25:31sustainablelivingforyou.com.au
2014-09-0209:25:31membersonlydiscount.com.au
2014-09-0209:35:31readygorates.com.au
2014-09-0209:35:31readygorate.com.au
2014-09-0209:35:31treeservicesnorthshore.com.au
2014-09-0209:35:31thatbrainyak.com.au
2014-09-0209:35:31rapidchangeworkshop.com.au
2014-09-0209:35:31ebolts.com.au
2014-09-0209:35:32mobilebookeeper.com.au
2014-09-0209:35:32d2creports.com.au
2014-09-0209:35:32exmouthrealty.com.au
2014-09-0209:35:37fullspectrumledlighting.net.au
2014-09-0209:35:37polacy.net.au
2014-09-0209:35:37fraudcast.net.au
2014-09-0209:35:37healthcarewebsitedesign.net.au
2014-09-0209:45:31angeco.com.au
2014-09-0209:45:31massagecloud.com.au
2014-09-0209:45:31ecolo.com.au
2014-09-0209:45:31buymygift.com.au
2014-09-0209:45:32academicpositions.com.au
2014-09-0209:45:32darylsim.com.au
2014-09-0209:45:32sugarmummas.com.au
2014-09-0209:45:32autograder.com.au
2014-09-0209:45:32dietersdream.com.au
2014-09-0209:45:32mistermachinery.com.au
2014-09-0209:45:32alohamassageretreat.com.au
2014-09-0209:45:37buymygift.net.au
2014-09-0209:45:37berghan.net.au
2014-09-0209:55:31unitedgrocery.com.au
2014-09-0209:55:31grandmastertools.com.au
2014-09-0209:55:31yourownmobilemechanic.com.au
2014-09-0209:55:31foodtop.com.au
2014-09-0209:55:31avocation.com.au
2014-09-0209:55:31indiantaste.com.au
2014-09-0209:55:31infusions.com.au
2014-09-0209:55:36ifsfuelcards.net.au
2014-09-0209:55:36integratedfuelcards.net.au
2014-09-0209:55:36unitedgrocery.net.au
2014-09-0209:55:36topfood.net.au
2014-09-0209:55:36avocation.net.au
2014-09-0209:55:36foodtop.net.au
2014-09-0209:55:36indiantaste.net.au
2014-09-0210:05:29eissolutions.com.au
2014-09-0210:05:29kicks4kids.com.au
2014-09-0210:05:29womenwithpurpose.com.au
2014-09-0210:05:29thewebdimensional.com.au
2014-09-0210:05:29boosttutoring.com.au
2014-09-0210:05:29weddingdanceshows.com.au
2014-09-0210:05:30safekeeper.com.au
2014-09-0210:05:30katstyle.com.au
2014-09-0210:05:35performancepartnership.net.au
2014-09-0210:05:35womenwithpurpose.net.au
2014-09-0210:15:31wizeandope.com.au
2014-09-0210:15:31cohereo.com.au
2014-09-0210:15:31treetrauma.com.au
2014-09-0210:25:31insurancesurveys.com.au
2014-09-0210:35:30cabover.com.au
2014-09-0210:35:30allybuildingsupplies.com.au
2014-09-0210:35:30blacktomato.com.au
2014-09-0210:35:30diyinvitekits.com.au
2014-09-0210:35:30hanleydesigns.com.au
2014-09-0210:45:31pressurecleaningtullamarine.com.au
2014-09-0210:45:31pressurecleaningcampbellfield.com.au
2014-09-0210:45:31sugarnsprinkles.com.au
2014-09-0210:55:29doska.com.au
2014-09-0210:55:30boingdomains.com.au
2014-09-0211:05:29superteach.com.au
2014-09-0211:05:29allgaragedoors.com.au
2014-09-0211:05:29alltypegaragedoors.com.au
2014-09-0211:05:29jamcam.com.au
2014-09-0211:05:29sueparbury.com.au
2014-09-0211:15:31readysteadygrow.com.au
2014-09-0211:15:31quoteadmin.com.au
2014-09-0211:25:29sweetybunch.com.au
2014-09-0211:25:30thereconnectivehealer.com.au
2014-09-0211:25:30linmel.com.au
2014-09-0211:25:30orioleconstruction.com.au
2014-09-0211:25:30getahealth.com.au
2014-09-0211:25:30retailsoft.com.au
2014-09-0211:25:30sooch.com.au
2014-09-0211:25:30leanspiration.com.au
2014-09-0211:35:30rjhpropertyinvestments.com.au
2014-09-0211:35:30salesconsignment.com.au
2014-09-0211:35:30quoteconsignment.com.au
2014-09-0211:35:30quoteadministrator.com.au
2014-09-0211:35:30blockstamp.com.au
2014-09-0211:35:30rjhpropertygroup.com.au
2014-09-0211:35:30serviceconsignment.com.au
2014-09-0211:35:30tradeconsignment.com.au
2014-09-0211:35:30qradministrator.com.au
2014-09-0211:35:30haugheymail.com.au
2014-09-0211:35:31bidformybusiness.com.au
2014-09-0211:35:31bid4mybusinrss.com.au
2014-09-0211:45:29craigmatthews.com.au
2014-09-0211:55:30carsright4u.com.au
2014-09-0211:55:31cartwrightmillionaire.com.au
2014-09-0211:55:31fashiontshirts.com.au
2014-09-0211:55:31thebaglady.com.au
2014-09-0211:55:36motorcyclesclothing.net.au
2014-09-0212:05:32alicespringsbackpackers.com.au
2014-09-0212:05:32southpawdesign.com.au
2014-09-0212:15:31litesign.com.au
2014-09-0212:25:31chaopersonaltrainer.com.au
2014-09-0212:25:32minkiemary.com.au
2014-09-0212:25:32litegroup.com.au
2014-09-0212:25:32wilgard.com.au
2014-09-0212:35:31removalsyarraville.com.au
2014-09-0212:35:31sydneytomelbourneremovalists.com.au
2014-09-0212:35:31shreddersupplies.com.au
2014-09-0212:45:31telemarketingaus.com.au
2014-09-0212:45:31iphoneaccessoriesonline.com.au
2014-09-0212:45:31bestinterstatemovers.com.au
2014-09-0212:45:31removalstruganina.com.au
2014-09-0212:45:31melbournetosydneyremovalists.com.au
2014-09-0212:55:31awfb.com.au
2014-09-0212:55:31norwestdata.com.au
2014-09-0212:55:31ciscoip.com.au
2014-09-0212:55:37sudanorphans.org.au
2014-09-0213:05:32rwestatemanagement.com.au
2014-09-0213:05:32paulryanprinting.com.au
2014-09-0213:05:32kidbay.com.au
2014-09-0213:05:32getting-projects-done.com.au
2014-09-0213:05:38kizmet.net.au
2014-09-0213:15:31australiancomputerexperts.com.au
2014-09-0213:15:31gamerlifestyle.com.au
2014-09-0213:15:31kcaadvisory.com.au
2014-09-0213:15:31spicycookingclasses.com.au
2014-09-0213:15:31thewoodpecker.com.au
2014-09-0213:15:32compcure.com.au
2014-09-0213:15:32socialeconomic.com.au
2014-09-0213:15:32vhq07.com.au
2014-09-0213:15:37kcaadvisory.net.au
2014-09-0213:25:30commandfirst.com.au
2014-09-0213:25:31greenshape.com.au
2014-09-0213:35:32boretti.com.au
2014-09-0213:35:32custombadge.com.au
2014-09-0213:35:32madamluxury.com.au
2014-09-0213:35:32basbiz.com.au
2014-09-0213:55:31ficowinebar.com.au
2014-09-0213:55:31onekravmaga.com.au
2014-09-0213:55:31clubchic.com.au
2014-09-0214:05:32geosellpropertyservices.com.au
2014-09-0214:05:32thinkworkingsmarter.com.au
2014-09-0214:05:32marquisoflorne.com.au
2014-09-0214:15:31escortswebsites.com.au
2014-09-0214:25:30jason-day.com.au
2014-09-0214:35:31bicton7daypharmacy.com.au
2014-09-0214:45:31jecounselling.com.au
2014-09-0214:45:31portableroundyards.com.au
2014-09-0214:45:31thanatology.com.au
2014-09-0214:45:31roundyardsaustralia.com.au
2014-09-0214:45:31wickedscreenprinting.com.au
2014-09-0214:55:31wollongongpropertyrentals.com.au
2014-09-0214:55:32albionparkpropertyrentals.com.au
2014-09-0214:55:32daptopropertyrentals.com.au
2014-09-0214:55:32harryandharriet.com.au
2014-09-0214:55:32kiamapropertyrentals.com.au
2014-09-0215:15:31sydneybabyhampers.com.au
2014-09-0215:25:31skydesign.com.au
2014-09-0215:25:31salumifiore.com.au
2014-09-0215:35:31crackerjackpainters.com.au
2014-09-0215:55:31peoplesoft.com.au
2014-09-0216:45:32tradiemobile.com.au
2014-09-0216:45:32tradieseo.com.au
2014-09-0217:05:31littlemissmotivate.com.au
2014-09-0217:55:31sydneysolartiles.com.au
2014-09-0217:55:31onlinesavingsaccountcomparison.com.au
2014-09-0217:55:31onlinesaveraccounts.com.au
2014-09-0217:55:31compareonlinesavingsaccounts.com.au
2014-09-0218:25:30andreamapp.com.au
2014-09-0219:25:31secretsfunctioncentre.com.au
2014-09-0220:25:31gollingsmasterpainters.com.au
2014-09-0220:35:31woodhallpainting.com.au
2014-09-0221:15:31clarkandsulman.com.au
2014-09-0221:45:31rodeocreative.com.au
2014-09-0221:55:35houseofflowers.net.au
2014-09-0222:05:31kidzswap.com.au
2014-09-0222:05:31ageingfrogfishba.com.au
2014-09-0222:05:32rochfordfundmanagement.com.au
2014-09-0222:05:32rochfordadvisory.com.au
2014-09-0222:05:32sportsprecinct.com.au
2014-09-0222:15:31actev8australia.com.au
2014-09-0222:15:31budgetbrochures.com.au
2014-09-0222:15:31bk004.com.au
2014-09-0222:25:31traininginthebowenbasin.com.au
2014-09-0222:25:31bowenbasintraining.com.au
2014-09-0222:25:31bowenbasinlife.com.au
2014-09-0222:25:31mandykosmalaphotography.com.au
2014-09-0222:25:31liveinthebowenbasin.com.au
2014-09-0222:35:37thereconnectivehealer.net.au
2014-09-0222:45:31lavishbaby.com.au
2014-09-0222:45:31fraudcast.com.au
2014-09-0222:45:31mrcah.com.au
2014-09-0222:45:31connectsoft.com.au
2014-09-0222:45:31mzparazzi.com.au
2014-09-0222:45:36getcovered.net.au
2014-09-0222:55:31carpetcleaningcockburncentral.com.au
2014-09-0222:55:31alessiglobal.com.au
2014-09-0222:55:31vissbeauty.com.au
2014-09-0222:55:31zestofbermagui.com.au
2014-09-0222:55:31bradpatonandassociates.com.au
2014-09-0222:55:31exitoholdings.com.au
2014-09-0222:55:31alladultads.com.au
2014-09-0223:05:31wolfecorpgmbh.com.au
2014-09-0223:05:31thedownies.com.au
2014-09-0223:05:31bradsantennaservice.com.au
2014-09-0223:05:31syar.com.au
2014-09-0223:05:31hardlineharriets.com.au
2014-09-0223:05:31colonialmarines.com.au
2014-09-0223:05:32theclick-clacklounge.com.au
2014-09-0223:05:32jointventurehouses.com.au
2014-09-0223:05:37zeroday.net.au
2014-09-0223:05:37smittenessence.net.au
2014-09-0223:15:31flowflakegarages.com.au
2014-09-0223:15:31eosjanuscapital.com.au
2014-09-0223:15:31mrmqld.com.au
2014-09-0223:15:31flowflakefloor.com.au
2014-09-0223:15:31carpet-cleaners-geelong.com.au
2014-09-0223:15:36rainmaking.net.au
2014-09-0223:25:31fireflythermalsystems.com.au
2014-09-0223:25:31stylemedarling.com.au
2014-09-0223:25:32awconsulting.com.au
2014-09-0223:25:32www1800daikin.com.au
2014-09-0223:25:32chiantigeografico.com.au
2014-09-0223:25:37specialistultrasound.net.au
2014-09-0223:25:37www1800daikin.net.au
2014-09-0223:25:38gunargarang.org.au
2014-09-0223:35:31decorstickers.com.au
2014-09-0223:35:31mobilevendingsales.com.au
2014-09-0223:35:31sysq.com.au
2014-09-0223:35:32cubicakeprintables.com.au
2014-09-0223:35:32jmproperty.com.au
2014-09-0223:35:32scullyrefrigerated.com.au
2014-09-0223:35:37designsystem.net.au
2014-09-0223:45:31pup-pets.com.au
2014-09-0223:45:31hirescully.com.au
2014-09-0223:45:32jeffmalpas.com.au
2014-09-0223:45:32hoteltcharity.com.au
2014-09-0223:45:32ssled.com.au
2014-09-0223:45:32rlaus.com.au
2014-09-0223:45:32konka-led.com.au
2014-09-0223:45:321800airconditioning.com.au
2014-09-0223:45:32formulaproperties.com.au
2014-09-0223:45:32linenandhome.com.au
2014-09-0223:45:32nail-it-beauty.com.au
2014-09-0223:45:32icallback.com.au
2014-09-0223:45:32thecoffeeforum.com.au
2014-09-0223:45:38formulaproperties.net.au
2014-09-0223:55:30hotelmelbourneairport.com.au
2014-09-0223:55:30transportrefrigerationsales.com.au
2014-09-0223:55:30lavenderblueprofessional.com.au
2014-09-0223:55:31vendingtrucksales.com.au
2014-09-0223:55:31vansrefrigeratedsales.com.au
2014-09-0223:55:31parcelsafe.com.au
2014-09-0223:55:31refrigerationtrucksales.com.au
2014-09-0223:55:31discountnotebooks.com.au
2014-09-0223:55:31truckrefrigerationsales.com.au
2014-09-0223:55:36discountnotebooks.net.au
2014-09-0223:55:36polarrevolution.net.au
2014-09-0223:55:37disabledphotographers.org.au
2014-09-0300:05:27i-pets.com.au
2014-09-0300:05:27lavinialee.com.au
2014-09-0300:05:27australianstartupexpo.com.au
2014-09-0300:05:42markhigginbottom.com.au
2014-09-0300:05:42bofs.com.au
2014-09-0300:05:49473.net.au
2014-09-0300:15:00algwawa.asn.au
2014-09-0300:15:31gold-green.com.au
2014-09-0300:15:31colpro.com.au
2014-09-0300:15:31accordions-midi.com.au
2014-09-0300:15:31autosec.com.au
2014-09-0300:15:32comfortinnparkside.com.au
2014-09-0300:15:32urbaynehomes.com.au
2014-09-0300:15:32southdevonbeefcattle.com.au
2014-09-0300:15:32webdesignexpert.com.au
2014-09-0300:15:32thepoultryplace.com.au
2014-09-0300:15:32kellaway.com.au
2014-09-0300:15:32onlineshedsaustralia.com.au
2014-09-0300:15:32hyro.com.au
2014-09-0300:15:32payrol.com.au
2014-09-0300:15:32new-hair.com.au
2014-09-0300:15:32ausfurnituretrading.com.au
2014-09-0300:15:32moto-zone.com.au
2014-09-0300:15:32rwmaddington.com.au
2014-09-0300:15:32firstnature.com.au
2014-09-0300:15:32thebigbrandsstore.com.au
2014-09-0300:15:32daylesfordholidays.com.au
2014-09-0300:15:33wickeddigital.com.au
2014-09-0300:15:33haveyougotthetouch.com.au
2014-09-0300:15:33asbqld.com.au
2014-09-0300:15:33goodcom.com.au
2014-09-0300:15:33bizforge.com.au
2014-09-0300:15:33holisticnetworkservices.com.au
2014-09-0300:15:33mothersdaypicnic.com.au
2014-09-0300:15:33fastrealestate.com.au
2014-09-0300:15:33rainwatertankpumps.com.au
2014-09-0300:15:33bakedbouquetsgifts.com.au
2014-09-0300:15:33littledrummer.com.au
2014-09-0300:15:33redcelllab.com.au
2014-09-0300:15:33storage-solutions.com.au
2014-09-0300:15:33physioconnect.com.au
2014-09-0300:15:34trolleymaster.com.au
2014-09-0300:15:34mysinger.com.au
2014-09-0300:15:34whodunnitmysterymurders.com.au
2014-09-0300:15:34alpha-c.com.au
2014-09-0300:15:34cleanerimage.com.au
2014-09-0300:15:34startssydney.com.au
2014-09-0300:15:34liscom.com.au
2014-09-0300:15:34touche.com.au
2014-09-0300:15:34telikplastering.com.au
2014-09-0300:15:34barefootproductions.com.au
2014-09-0300:15:34eventscentralcoast.com.au
2014-09-0300:15:34chrishutchison.com.au
2014-09-0300:15:34totalrecallmovie.com.au
2014-09-0300:15:34springfern.com.au
2014-09-0300:15:35carellihaircare.com.au
2014-09-0300:15:35minipaks.com.au
2014-09-0300:15:35camouflage.com.au
2014-09-0300:15:35prestonimpressions.com.au
2014-09-0300:15:35seascapeboats.com.au
2014-09-0300:15:35everypc.com.au
2014-09-0300:15:35nowrinkles.com.au
2014-09-0300:15:35barmaids.com.au
2014-09-0300:15:35secretarialsupport.com.au
2014-09-0300:15:35gardasilclub.com.au
2014-09-0300:15:35degrees-catering.com.au
2014-09-0300:15:35bukhararestaurant.com.au
2014-09-0300:15:35totalrecall-movie.com.au
2014-09-0300:15:3512thman.com.au
2014-09-0300:15:35whitening.com.au
2014-09-0300:15:35foodservices.com.au
2014-09-0300:15:36feathersnestcreations.com.au
2014-09-0300:15:36robewineregion.com.au
2014-09-0300:15:36space-works.com.au
2014-09-0300:15:36imeasure.com.au
2014-09-0300:15:36wizardsigns.com.au
2014-09-0300:15:36wedding-wishes.com.au
2014-09-0300:15:36whiten.com.au
2014-09-0300:15:36toptools.com.au
2014-09-0300:15:36sweetrain.com.au
2014-09-0300:15:364one5.com.au
2014-09-0300:15:36ventri.com.au
2014-09-0300:15:36sharma.com.au
2014-09-0300:15:36clydesdalesrestaurant.com.au
2014-09-0300:15:36actrain.com.au
2014-09-0300:15:37jameskendall.id.au
2014-09-0300:15:41enterprisecharters.net.au
2014-09-0300:15:41editorial.net.au
2014-09-0300:15:42lakeeyrebasin.org.au
2014-09-0300:15:42zontabrisbaneriver.org.au
2014-09-0300:25:31shishalounge.com.au
2014-09-0300:25:31into-gems.com.au
2014-09-0300:25:31whatgoesaround.com.au
2014-09-0300:25:32horseandponyparties.com.au
2014-09-0300:25:32onlyinternet.com.au
2014-09-0300:25:32safariafricanrestaurant.com.au
2014-09-0300:25:32goldcoastmortgagemanagement.com.au
2014-09-0300:25:32x-tream.com.au
2014-09-0300:25:32shishacafe.com.au
2014-09-0300:25:32meetingshout.com.au
2014-09-0300:25:32alwalsh.com.au
2014-09-0300:25:37hirenewcastle.net.au
2014-09-0300:35:31tshirtimpressions.com.au
2014-09-0300:35:31newcastlecarandtruckrental.com.au
2014-09-0300:35:31nlecmelbourne.com.au
2014-09-0300:35:31studio2204.com.au
2014-09-0300:35:31greencactus.com.au
2014-09-0300:35:31supremeroofingandguttering.com.au
2014-09-0300:35:31fastfriendships.com.au
2014-09-0300:35:32b4blocal.com.au
2014-09-0300:35:32localhomeshopping.com.au
2014-09-0300:35:32onphosting.com.au
2014-09-0300:35:37napoligroup.net.au
2014-09-0300:35:37lovemyvintage.net.au
2014-09-0300:45:31style4me.com.au
2014-09-0300:45:31hillcrestcottage.com.au
2014-09-0300:45:31princesscruisespecialist.com.au
2014-09-0300:45:31pinandwinaustralia.com.au
2014-09-0300:45:32canadacruise.com.au
2014-09-0300:45:32pocruisespecialists.com.au
2014-09-0300:45:32pontvillepub.com.au
2014-09-0300:45:32pacificdawncruises.com.au
2014-09-0300:45:32challengeseries.com.au
2014-09-0300:45:32keko.com.au
2014-09-0300:45:32blueberrydesign.com.au
2014-09-0300:45:32diamondprincesscruises.com.au
2014-09-0300:45:32ilovecakes.com.au
2014-09-0300:45:32sunprincesscruises.com.au
2014-09-0300:45:32propertyontrack.com.au
2014-09-0300:45:323eemedia.com.au
2014-09-0300:45:32princesscruisespecialists.com.au
2014-09-0300:45:32dromanaprinting-yellowpages.com.au
2014-09-0300:45:33papallo.id.au
2014-09-0300:45:38ilovecakes.net.au
2014-09-0300:45:38into-gems.net.au
2014-09-0300:45:38cruiseseurope.net.au
2014-09-0300:45:38intogems.net.au
2014-09-0300:45:39intensity.org.au
2014-09-0300:55:32yinyangpromo.com.au
2014-09-0300:55:32cruisesgreek.com.au
2014-09-0300:55:32minersclub.com.au
2014-09-0300:55:32charlieblack.com.au
2014-09-0300:55:32smfbuildingmaintenance.com.au
2014-09-0300:55:32raisinginfinitefunds.com.au
2014-09-0300:55:33singlemodesolutions.com.au
2014-09-0300:55:33babyhq.com.au
2014-09-0300:55:33myfashionlook.com.au
2014-09-0300:55:33hallamautomotive.com.au
2014-09-0300:55:33courtenaysmith.com.au
2014-09-0300:55:33peitaschoice.com.au
2014-09-0300:55:38dazzledrydistributoraustralianz.net.au
2014-09-0301:05:31cruisescaribbean.com.au
2014-09-0301:05:31oaksministries.com.au
2014-09-0301:05:31themuscleclinic.com.au
2014-09-0301:05:31cantinamarino.com.au
2014-09-0301:05:31scottscarcarrying.com.au
2014-09-0301:05:31cerrodelacruz.com.au
2014-09-0301:05:31mindtomarket.com.au
2014-09-0301:05:31cruiseitaly.com.au
2014-09-0301:05:37tshirtimpressions.net.au
2014-09-0301:05:37blueberrydesign.net.au
2014-09-0301:15:31connellanwines.com.au
2014-09-0301:15:31justtellmeicant.com.au
2014-09-0301:15:31dedicateddentaldirect.com.au
2014-09-0301:15:31ellielucassolutions.com.au
2014-09-0301:15:31karenlewin.com.au
2014-09-0301:15:31bellybliss.com.au
2014-09-0301:15:31mysticaldiva.com.au
2014-09-0301:25:31ohs-training-australia.com.au
2014-09-0301:25:31study-ohs.com.au
2014-09-0301:25:31mmdconsulting.com.au
2014-09-0301:25:31mandikingglass.com.au
2014-09-0301:25:31bottle-o-bulleen.com.au
2014-09-0301:25:31terradorata.com.au
2014-09-0301:25:31prenupsinaustralia.com.au
2014-09-0301:25:31occupational-health-safety.com.au
2014-09-0301:25:31jewelleryholders.com.au
2014-09-0301:25:32cityviewbc.com.au
2014-09-0301:25:32brendanbowerfinance.com.au
2014-09-0301:25:32ohs-course-australia.com.au
2014-09-0301:25:32matuzalem.com.au
2014-09-0301:25:32bigboyrendering.com.au
2014-09-0301:25:32businessbuildersgroup.com.au
2014-09-0301:25:32methuselah.com.au
2014-09-0301:25:32australian-philippine-freight-service-apfs.com.au
2014-09-0301:25:37karenlewin.net.au
2014-09-0301:25:37thedownies.net.au
2014-09-0301:35:31empiremeat.com.au
2014-09-0301:35:31debsdanceandfancydress.com.au
2014-09-0301:35:31usedcaravanmelbourne.com.au
2014-09-0301:35:31debtagreementprovider.com.au
2014-09-0301:35:31localbusinesspark.com.au
2014-09-0301:35:31rrnet.com.au
2014-09-0301:35:31missluxury.com.au
2014-09-0301:35:32tradesmantrailersmelbourne.com.au
2014-09-0301:35:32pdcd.com.au
2014-09-0301:35:32regionalreplacementnetwork.com.au
2014-09-0301:35:32rrnetwork.com.au
2014-09-0301:35:32mrluxury.com.au
2014-09-0301:45:31cedunamotel.com.au
2014-09-0301:45:31queenslanddrugcharges.com.au
2014-09-0301:45:32nswdrugoffences.com.au
2014-09-0301:45:32julou.com.au
2014-09-0301:55:31lifehousehub.com.au
2014-09-0301:55:31empiremeatwholesalers.com.au
2014-09-0301:55:31ntlingerie.com.au
2014-09-0301:55:36lollybuffethire.net.au
2014-09-0302:05:30posaccounts.com.au
2014-09-0302:05:30words-etc.com.au
2014-09-0302:05:31paydirt-computing.com.au
2014-09-0302:05:31posaccount.com.au
2014-09-0302:05:31aussieminershomeloans.com.au
2014-09-0302:05:31homestylecookies.com.au
2014-09-0302:05:31paydirtcomputing.com.au
2014-09-0302:05:36paydirtcomputing.net.au
2014-09-0302:05:36paydirt.net.au
2014-09-0302:05:36wisdomteeth.net.au
2014-09-0302:15:31onenightonlylive.com.au
2014-09-0302:15:31pacificislanddirectory.com.au
2014-09-0302:15:31appaffair.com.au
2014-09-0302:15:31makeupandglowacademy.com.au
2014-09-0302:15:31rednoodle.com.au
2014-09-0302:15:31vartanianholdings.com.au
2014-09-0302:15:31orluchiana.com.au
2014-09-0302:15:31cocktailmobile.com.au
2014-09-0302:15:31surewasher.com.au
2014-09-0302:15:31lovesports.com.au
2014-09-0302:15:31distinctdental-yellowpages.com.au
2014-09-0302:15:31katalystfoundation.com.au
2014-09-0302:15:32zapmyvideo.com.au
2014-09-0302:15:32sourceintentions.com.au
2014-09-0302:15:32loketechnologies.com.au
2014-09-0302:15:32gallopulator.com.au
2014-09-0302:15:32irepairiphones.com.au
2014-09-0302:15:32oztags.com.au
2014-09-0302:15:32harmancntrctng-yellowpages.com.au
2014-09-0302:15:32nccode.com.au
2014-09-0302:15:37vartanianholdings.net.au
2014-09-0302:15:37onlinecareerdevelopment.net.au
2014-09-0302:15:37gimme-it.net.au
2014-09-0302:15:37ncc.net.au
2014-09-0302:15:37gimmeit.net.au
2014-09-0302:25:32outdoordigitalmedia.com.au
2014-09-0302:25:32fastandfemale.com.au
2014-09-0302:25:32chillicoolrooms.com.au
2014-09-0302:25:32quitcigaretteslogancity.com.au
2014-09-0302:25:32surewash.com.au
2014-09-0302:25:32quitsmokinglogancity.com.au
2014-09-0302:25:32groupservice.com.au
2014-09-0302:25:32centrepiecesdesign.com.au
2014-09-0302:25:33commercetechnicians.com.au
2014-09-0302:25:33sure-wash.com.au
2014-09-0302:25:33noelblundellrealestate.com.au
2014-09-0302:25:33wetandwildcarwash.com.au
2014-09-0302:25:33thisisreal.com.au
2014-09-0302:25:33mrgravity.com.au
2014-09-0302:25:33naturopathkate.com.au
2014-09-0302:25:33barcodemagnets.com.au
2014-09-0302:25:33bnevideo.com.au
2014-09-0302:25:38bikefixtation.net.au
2014-09-0302:25:38ribbed.net.au
2014-09-0302:25:38groupservice.net.au
2014-09-0302:25:38commercetechnicians.net.au
2014-09-0302:35:31heart-tours.com.au
2014-09-0302:35:31internetbusinessexpo.com.au
2014-09-0302:35:31completecontracting.com.au
2014-09-0302:35:31lasercastlehill.com.au
2014-09-0302:35:31subahevana.com.au
2014-09-0302:35:31residentsagainstswanvalleyjusticecentre.com.au
2014-09-0302:35:31nelsonplace.com.au
2014-09-0302:35:31godsavethequeen.com.au
2014-09-0302:35:32fastmobilesites.com.au
2014-09-0302:35:32dtkplumbing.com.au
2014-09-0302:35:32netbusinessexpo.com.au
2014-09-0302:35:32blundellrealestate.com.au
2014-09-0302:35:32luxman.com.au
2014-09-0302:35:32luxurylathers.com.au
2014-09-0302:35:32worstfilmever.com.au
2014-09-0302:35:32dorrigobedandbreakfast.com.au
2014-09-0302:35:32allianceyouth.com.au
2014-09-0302:35:37blendglobaltappas.net.au
2014-09-0302:35:37luxurylathers.net.au
2014-09-0302:35:37netbusinessexpo.net.au
2014-09-0302:35:37myinvestmenttrends.net.au
2014-09-0302:35:37internetbusinessexpo.net.au
2014-09-0302:45:31fashaholics.com.au
2014-09-0302:45:31toyotaconcierge.com.au
2014-09-0302:45:31datataylor.com.au
2014-09-0302:45:31morleypark.com.au
2014-09-0302:45:32a-c-b.com.au
2014-09-0302:45:32iwantmystuffdone.com.au
2014-09-0302:45:32amazonlandscapes.com.au
2014-09-0302:45:32gazeboshelter.com.au
2014-09-0302:45:32aquariteplumbingservices.com.au
2014-09-0302:45:32onsite-computer-repair.com.au
2014-09-0302:45:32headphonesforexercise.com.au
2014-09-0302:45:32magnumfx.com.au
2014-09-0302:45:32yourperfectlocation.com.au
2014-09-0302:45:32nurtureplus.com.au
2014-09-0302:45:38iphoneapps.net.au
2014-09-0302:45:38foodjobs.net.au
2014-09-0302:55:31e-diversity.com.au
2014-09-0302:55:31printingmachinesales.com.au
2014-09-0302:55:31smartbizbuyer.com.au
2014-09-0302:55:31ipatrols.com.au
2014-09-0302:55:31oneperfectsong.com.au
2014-09-0302:55:31hollandinteriors.com.au
2014-09-0302:55:32treasuredtots.com.au
2014-09-0302:55:32gregsmowing.com.au
2014-09-0302:55:32dogswags.com.au
2014-09-0302:55:37e-diversity.net.au
2014-09-0302:55:37imark.net.au
2014-09-0302:55:37startrak.net.au
2014-09-0302:55:38sfcaustralia.org.au
2014-09-0303:05:33goodalldineengroup.com.au
2014-09-0303:05:34orcrist.com.au
2014-09-0303:05:34vertexvibration.com.au
2014-09-0303:05:34gettackle.com.au
2014-09-0303:05:34wrigleyshandyman.com.au
2014-09-0303:05:34wsiplus.com.au
2014-09-0303:05:34trainlikeachampion.com.au
2014-09-0303:05:34desciple.com.au
2014-09-0303:05:34e-advisor.com.au
2014-09-0303:05:35tsps.com.au
2014-09-0303:05:35iamamcal.com.au
2014-09-0303:05:35spapools-sydney.com.au
2014-09-0303:05:35spapools-melbourne.com.au
2014-09-0303:05:35futurethought.com.au
2014-09-0303:05:36electricalearthing.com.au
2014-09-0303:05:36homeloanchannel.com.au
2014-09-0303:05:36cloudlearning.com.au
2014-09-0303:05:36shaktipath.com.au
2014-09-0303:05:36spapools-brisbane.com.au
2014-09-0303:05:36e-engage.com.au
2014-09-0303:05:36x8learning.com.au
2014-09-0303:05:36caffedamitolo.com.au
2014-09-0303:05:42desciple.net.au
2014-09-0303:05:42socialentrepreneur.net.au
2014-09-0303:05:43orcrist.net.au
2014-09-0303:15:27perthstudentsaccommodation.com.au
2014-09-0303:15:28dubiel.com.au
2014-09-0303:15:28adelaideshareaccommodation.com.au
2014-09-0303:15:28brazillianwaxing.com.au
2014-09-0303:15:28wallpaperperth.com.au
2014-09-0303:15:28ourvirtualassistant.com.au
2014-09-0303:15:28energyauditor.com.au
2014-09-0303:15:28petiteboutique.com.au
2014-09-0303:15:28perthinteriordesigner.com.au
2014-09-0303:15:28mylocalescort.com.au
2014-09-0303:15:28geothermaladvisory.com.au
2014-09-0303:15:28textra.com.au
2014-09-0303:15:28dailyspecial.com.au
2014-09-0303:15:28goodhealthmatters.com.au
2014-09-0303:15:28clarkeconsulting.com.au
2014-09-0303:15:28vinylbar.com.au
2014-09-0303:15:28jewelleryleaders.com.au
2014-09-0303:15:28whitemoney.com.au
2014-09-0303:15:28escortagenciesperth.com.au
2014-09-0303:15:28magjiik.com.au
2014-09-0303:15:28perspectivesworks.com.au
2014-09-0303:15:28laserhairremoval-brisbane.com.au
2014-09-0303:15:28eiastudy.com.au
2014-09-0303:15:28vintageandmodern.com.au
2014-09-0303:15:28brisbanelimoforhire.com.au
2014-09-0303:15:28diamondsring.com.au
2014-09-0303:15:28salestalent.com.au
2014-09-0303:15:29fmayerimports.com.au
2014-09-0303:15:29yogashop.com.au
2014-09-0303:15:29grautoelectrics.com.au
2014-09-0303:15:29equipsalesonline.com.au
2014-09-0303:15:29perthstudenthousing.com.au
2014-09-0303:15:29peninsulapointplumbing.com.au
2014-09-0303:15:29exportbrisbane.com.au
2014-09-0303:15:29bricklayerssunshinecoast.com.au
2014-09-0303:15:29zbrush.com.au
2014-09-0303:15:29thinkaccountants.com.au
2014-09-0303:15:29googlemapsadvertising.com.au
2014-09-0303:15:29escortagenciesbrisbane.com.au
2014-09-0303:15:29escortagenciesadelaide.com.au
2014-09-0303:15:29escortagenciescanberra.com.au
2014-09-0303:15:29diamondsrings.com.au
2014-09-0303:15:29viviantamhealth.com.au
2014-09-0303:15:29childharness.com.au
2014-09-0303:15:29jiw.com.au
2014-09-0303:15:29baligardens.com.au
2014-09-0303:15:29taxinvoiceonline.com.au
2014-09-0303:15:29quotesheet.com.au
2014-09-0303:15:29australiataxreturnonline.com.au
2014-09-0303:15:29sellpropertyonline.com.au
2014-09-0303:15:29makemoneyhome.com.au
2014-09-0303:15:29rcsurveys.com.au
2014-09-0303:15:29emissioncredits.com.au
2014-09-0303:15:29greensales.com.au
2014-09-0303:15:29boxgutter.com.au
2014-09-0303:15:29advancedledsolutions.com.au
2014-09-0303:15:29conflictdiamonds.com.au
2014-09-0303:15:29allorganicsdirect.com.au
2014-09-0303:15:29escortagencieshobart.com.au
2014-09-0303:15:30emissionsmanagementaustralia.com.au
2014-09-0303:15:30brazillianhairremoval.com.au
2014-09-0303:15:30poolsafetycover.com.au
2014-09-0303:15:30monarchentertainment.com.au
2014-09-0303:15:30agave.com.au
2014-09-0303:15:30cookindian.com.au
2014-09-0303:15:30fmayer.com.au
2014-09-0303:15:30dollardiscounts.com.au
2014-09-0303:15:30marriageclinic.com.au
2014-09-0303:15:30winewholesale.com.au
2014-09-0303:15:30mcdowallpainting.com.au
2014-09-0303:15:30landscapingpropertymaintenance.com.au
2014-09-0303:15:30nanomoleculartechnology.com.au
2014-09-0303:15:30powerpointpresentations.com.au
2014-09-0303:15:30energyratingonline.com.au
2014-09-0303:15:30escortagenciesdarwin.com.au
2014-09-0303:15:30onlinehandbagshop.com.au
2014-09-0303:15:30netdebt.com.au
2014-09-0303:15:30ratemyemployer.com.au
2014-09-0303:15:30strategicbusinessbrokers.com.au
2014-09-0303:15:30andrewplimmer.com.au
2014-09-0303:15:30innovativesolar.com.au
2014-09-0303:15:30internationalmodels.com.au
2014-09-0303:15:30customsbrokeronline.com.au
2014-09-0303:15:30escortagenciessydney.com.au
2014-09-0303:15:30websitelogodesign.com.au
2014-09-0303:15:30socialbids.com.au
2014-09-0303:15:30thehealingproject.com.au
2014-09-0303:15:31joinhaba.com.au
2014-09-0303:15:31brisbane-shareaccommodation.com.au
2014-09-0303:15:31industrialcommercialcleaning.com.au
2014-09-0303:15:31socialmediastrategymanagement.com.au
2014-09-0303:15:31mineralresourcerenttax.com.au
2014-09-0303:15:31goodsexweek.com.au
2014-09-0303:15:31brazillianwaxingmelbourne.com.au
2014-09-0303:15:31whatsinthebigbrownbox.com.au
2014-09-0303:15:31goldcoaststudentsaccommodation.com.au
2014-09-0303:15:31wickedsexads.com.au
2014-09-0303:15:35appletreelaw.com.au
2014-09-0303:15:35tornclothing.com.au
2014-09-0303:15:35dlwa.com.au
2014-09-0303:15:35allorganicdirect.com.au
2014-09-0303:15:35benchmarkrestaurant.com.au
2014-09-0303:15:35sellmygun.com.au
2014-09-0303:15:35exhibitionlightingaustralia.com.au
2014-09-0303:15:35socialbidz.com.au
2014-09-0303:15:35sahcomp.com.au
2014-09-0303:15:35jewelleryleader.com.au
2014-09-0303:15:40grautoelectrics.net.au
2014-09-0303:15:40crystalhealing.net.au
2014-09-0303:15:40energyauditor.net.au
2014-09-0303:15:40yogahouse.net.au
2014-09-0303:15:40companylogodesign.net.au
2014-09-0303:15:40onlinemarketingservices.net.au
2014-09-0303:15:40handbagshop.net.au
2014-09-0303:15:40service2u.net.au
2014-09-0303:15:40melbournebuilders.net.au
2014-09-0303:15:40directestimating.net.au
2014-09-0303:15:40laser-hair-removal.net.au
2014-09-0303:25:30familyitalian.com.au
2014-09-0303:25:30rossinicafe.com.au
2014-09-0303:25:30italiangoldcoast.com.au
2014-09-0303:25:30milliondollarvandal.com.au
2014-09-0303:25:31nappyshop.com.au
2014-09-0303:25:31bestitaliangoldcoast.com.au
2014-09-0303:25:31warriorwithinpt.com.au
2014-09-0303:25:31goldcoastitalian.com.au
2014-09-0303:25:31mbpi.com.au
2014-09-0303:25:31comfortkeeper.com.au
2014-09-0303:25:31montvilleorganicskincare.com.au
2014-09-0303:25:31steellife.com.au
2014-09-0303:25:31bestaussiefood.com.au
2014-09-0303:25:31aufoodreview.com.au
2014-09-0303:25:31myorganicbody.com.au
2014-09-0303:25:31harponiclearning.com.au
2014-09-0303:25:31rossinicaferestaurant.com.au
2014-09-0303:25:36tbg.net.au
2014-09-0303:25:37harponic.net.au
2014-09-0303:35:31viaquinaustralia.com.au
2014-09-0303:35:31fireflyinteriors.com.au
2014-09-0303:35:31ulladulladining.com.au
2014-09-0303:35:31shinept.com.au
2014-09-0303:35:31team13.com.au
2014-09-0303:35:31shinefitnesstraining.com.au
2014-09-0303:35:31littlelostwonders.com.au
2014-09-0303:35:31guttersandgardens.com.au
2014-09-0303:35:31shinebootcamp.com.au
2014-09-0303:35:31globalfitnessdirectory.com.au
2014-09-0303:35:31viasprayaustralia.com.au
2014-09-0303:35:31viaquin-australia.com.au
2014-09-0303:35:31viaspray-australia.com.au
2014-09-0303:35:31superatstake.com.au
2014-09-0303:35:31cyclossage.com.au
2014-09-0303:35:31cyclo-ssage.com.au
2014-09-0303:35:32grazeatnorthwesttas.com.au
2014-09-0303:35:37harponiclearning.net.au
2014-09-0303:35:37firstcapital.net.au
2014-09-0303:35:37tailsupdogtraining.net.au
2014-09-0303:45:32silvertigergifts.com.au
2014-09-0303:45:32gentlemanzombie.com.au
2014-09-0303:45:32musicagency.com.au
2014-09-0303:45:32myjetlimo.com.au
2014-09-0303:45:32alceefashion.com.au
2014-09-0303:45:32seamusjames.com.au
2014-09-0303:45:32ecostonecladding.com.au
2014-09-0303:45:32stayontop.com.au
2014-09-0303:45:32fsspty.com.au
2014-09-0303:45:32diamondtigertrading.com.au
2014-09-0303:45:32freedomfunds.com.au
2014-09-0303:45:32taylored-assessments.com.au
2014-09-0303:45:32fasciasonline.com.au
2014-09-0303:45:38leadershipaustralia.net.au
2014-09-0303:45:38eleadership.net.au
2014-09-0303:45:38freedomfunds.net.au
2014-09-0303:45:38ileadership.net.au
2014-09-0303:45:38taylored-assessments.net.au
2014-09-0303:45:38ecostone.net.au
2014-09-0303:45:38fasciasonline.net.au
2014-09-0303:55:30pop-posse.com.au
2014-09-0303:55:30buenavibra.com.au
2014-09-0303:55:31rippalax.com.au
2014-09-0303:55:31alcee.com.au
2014-09-0303:55:31bodyrevivesolutions.com.au
2014-09-0303:55:31officeprintpromotional.com.au
2014-09-0303:55:31hearnsflorist.com.au
2014-09-0303:55:31salon209.com.au
2014-09-0303:55:31forensicbc.com.au
2014-09-0303:55:31brightelectricalsolutions.com.au
2014-09-0303:55:31slimsisters.com.au
2014-09-0303:55:31eliterehab.com.au
2014-09-0303:55:31oscotransport.com.au
2014-09-0303:55:31ourchildis.com.au
2014-09-0303:55:31lunchboxheroes.com.au
2014-09-0303:55:32theslimmingcompany.com.au
2014-09-0303:55:32ttsg.com.au
2014-09-0303:55:32ourbabyis.com.au
2014-09-0303:55:32etchedintime.com.au
2014-09-0303:55:37precisionsheetmetal.net.au
2014-09-0303:55:37tarpaulin.net.au
2014-09-0303:55:37bikesdever.net.au
2014-09-0304:05:32cabads.com.au
2014-09-0304:05:32portadelaidefcheritage.com.au
2014-09-0304:05:32linnperth.com.au
2014-09-0304:05:32demelcleaning.com.au
2014-09-0304:05:32in2flooring.com.au
2014-09-0304:05:32processserversgoldcoast.com.au
2014-09-0304:05:32printsofpeace.com.au
2014-09-0304:05:32linnaudio.com.au
2014-09-0304:05:32investjewellery.com.au
2014-09-0304:05:32processserversbrisbane.com.au
2014-09-0304:05:32nbscladding.com.au
2014-09-0304:05:32sweetsensationcupcakes.com.au
2014-09-0304:05:32thelinncentreperth.com.au
2014-09-0304:05:32ilegraconsulting.com.au
2014-09-0304:05:32btforensics.com.au
2014-09-0304:05:32dougfurzemarriagecelebtrant.com.au
2014-09-0304:05:32whiteknightservices.com.au
2014-09-0304:05:32walktoremember.com.au
2014-09-0304:05:32livinginresearch.com.au
2014-09-0304:05:32thegggroup.com.au
2014-09-0304:05:32cabadsaustralia.com.au
2014-09-0304:05:33intrapreneurship.com.au
2014-09-0304:05:33onlinesecuritytech.com.au
2014-09-0304:05:33woknbowl.com.au
2014-09-0304:05:33supportingsophie.com.au
2014-09-0304:05:33littlecutie.com.au
2014-09-0304:05:38cabads.net.au
2014-09-0304:05:38cabadsaustralia.net.au
2014-09-0304:15:31rampageskatepark.com.au
2014-09-0304:15:31directionexploring.com.au
2014-09-0304:15:31victorylive.com.au
2014-09-0304:15:31dunefit.com.au
2014-09-0304:15:31saleswsre.com.au
2014-09-0304:15:31bombdiggity.com.au
2014-09-0304:15:32digitaltransformations.com.au
2014-09-0304:15:32jimmydelgados.com.au
2014-09-0304:15:32getyourartsintogear.com.au
2014-09-0304:15:32pinkdominosflorist.com.au
2014-09-0304:15:32quesyrah.com.au
2014-09-0304:15:32epicroadtime.com.au
2014-09-0304:15:32webcsm.com.au
2014-09-0304:15:32plumptonmedicalcentre.com.au
2014-09-0304:15:32springbargain.com.au
2014-09-0304:15:32acceleratedcre.com.au
2014-09-0304:15:32acceleratedluxuryhomes.com.au
2014-09-0304:15:32newschomper.com.au
2014-09-0304:15:32ibpaustralia.com.au
2014-09-0304:15:32mystyleonline.com.au
2014-09-0304:15:32plumptonmedical.com.au
2014-09-0304:15:32plumpton-medical.com.au
2014-09-0304:15:37springfestival.net.au
2014-09-0304:15:37preparetrainsurvive.net.au
2014-09-0304:15:37prescribed.net.au
2014-09-0304:25:31gameandwatchshop.com.au
2014-09-0304:25:31deniliquintastezcatering.com.au
2014-09-0304:25:31genesisfitnesscourses.com.au
2014-09-0304:25:31advertisingpromotionalpens.com.au
2014-09-0304:25:31lawyersinhouse.com.au
2014-09-0304:25:31echucatastezcatering.com.au
2014-09-0304:25:31technicalpartners.com.au
2014-09-0304:25:31cheappromotionalproduct.com.au
2014-09-0304:25:31abifit.com.au
2014-09-0304:25:31moamatastezcatering.com.au
2014-09-0304:25:32agedcareview.com.au
2014-09-0304:25:32prorailaustralia.com.au
2014-09-0304:25:32contemporaryleadership.com.au
2014-09-0304:25:32cheapcap.com.au
2014-09-0304:25:37prepaiddebitcards.net.au
2014-09-0304:25:37savingsaccountcomparison.net.au
2014-09-0304:25:37point618.net.au
2014-09-0304:25:37agedcareview.net.au
2014-09-0304:25:37automaticgate.net.au
2014-09-0304:25:37lawyersinhouse.net.au
2014-09-0304:25:37kimberleyproducts.net.au
2014-09-0304:25:37zipa.net.au
2014-09-0304:35:31dirttracktv.com.au
2014-09-0304:35:31brushstopsalon.com.au
2014-09-0304:35:31onlinegolfschool.com.au
2014-09-0304:35:31ozzic.com.au
2014-09-0304:35:31fourtwelve.com.au
2014-09-0304:35:31lachook.com.au
2014-09-0304:35:32thursdaythundermedia.com.au
2014-09-0304:35:32drandrewmurray.com.au
2014-09-0304:35:32beehomes.com.au
2014-09-0304:35:32cruxs.com.au
2014-09-0304:35:32justinbeiber.com.au
2014-09-0304:35:37myfuel.net.au
2014-09-0304:35:37cruxs.net.au
2014-09-0304:35:37justinbeiber.net.au
2014-09-0304:45:30unigogogo.com.au
2014-09-0304:45:30hospitalitymentors.com.au
2014-09-0304:45:30ozgogogo.com.au
2014-09-0304:45:30chilax.com.au
2014-09-0304:45:31solarbuyersdirect.com.au
2014-09-0304:45:31kirarobsonarchitect.com.au
2014-09-0304:45:31customsbrokerexpress.com.au
2014-09-0304:45:31govital.com.au
2014-09-0304:45:31jcphelectrical.com.au
2014-09-0304:45:31errormessage.com.au
2014-09-0304:45:31thefashionhorse.com.au
2014-09-0304:45:31sahaulearthaust.com.au
2014-09-0304:45:31bambooroo.com.au
2014-09-0304:45:31my3dprintonline.com.au
2014-09-0304:45:31rlservices.com.au
2014-09-0304:45:31myshoprunner.com.au
2014-09-0304:45:31wondershopfilms.com.au
2014-09-0304:45:31twobluebobbins.com.au
2014-09-0304:45:31malolo.com.au
2014-09-0304:45:31168uni.com.au
2014-09-0304:45:31pcsydney.com.au
2014-09-0304:45:31flowerscentralcoast.com.au
2014-09-0304:45:31shopbites.com.au
2014-09-0304:45:31happydeal.com.au
2014-09-0304:45:32photographercentralcoast.com.au
2014-09-0304:45:32thebakerboys.com.au
2014-09-0304:55:32isthathelene.com.au
2014-09-0304:55:32iqswitch.com.au
2014-09-0304:55:32jvsolar.com.au
2014-09-0304:55:32easylaserparty.com.au
2014-09-0304:55:32jojo-media.com.au
2014-09-0304:55:32braving.com.au
2014-09-0304:55:32processlaw.com.au
2014-09-0304:55:32connect2animals.com.au
2014-09-0304:55:32japanesesushiormond.com.au
2014-09-0304:55:32investmnetproperties.com.au
2014-09-0304:55:32taswatchclockco.com.au
2014-09-0304:55:32continuous-improvement.com.au
2014-09-0304:55:32littlebohemeboutique.com.au
2014-09-0304:55:32careerwisegroup.com.au
2014-09-0304:55:33lastlongernow.com.au
2014-09-0304:55:33performancephotos.com.au
2014-09-0304:55:33rishirish.com.au
2014-09-0304:55:33stephenbailey.id.au
2014-09-0304:55:38pcra.net.au
2014-09-0304:55:38corptow.net.au
2014-09-0304:55:38jojo-media.net.au
2014-09-0304:55:38fernandezfamily.net.au
2014-09-0304:55:38connect2animals.net.au
2014-09-0304:55:38jojomedia.net.au
2014-09-0304:55:38iqswitch.net.au
2014-09-0305:05:32plantationpleasures.com.au
2014-09-0305:05:32darwinratings.com.au
2014-09-0305:05:32ourbrownes.com.au
2014-09-0305:05:32weloveclover.com.au
2014-09-0305:05:32keepitclose.com.au
2014-09-0305:05:32chairaddict.com.au
2014-09-0305:05:32undergroundbillionaire.com.au
2014-09-0305:05:32joshuacurtis.com.au
2014-09-0305:05:32dashart.com.au
2014-09-0305:05:32kmacpt.com.au
2014-09-0305:05:37healthywealthyandwise.net.au
2014-09-0305:15:31macedonrangesbusinesssupport.com.au
2014-09-0305:15:31jessieo.com.au
2014-09-0305:15:32macedonrangessecretary.com.au
2014-09-0305:15:32kanicoupons.com.au
2014-09-0305:15:32leadlegends.com.au
2014-09-0305:15:32maxskating.com.au
2014-09-0305:15:32thenewenglandhotel.com.au
2014-09-0305:15:32arpsmash.com.au
2014-09-0305:15:32domesticpestcontrolperth.com.au
2014-09-0305:15:32underdogbillionaire.com.au
2014-09-0305:15:32adelaiderainwatertanks.com.au
2014-09-0305:15:32sofiarestaurantbalwyn.com.au
2014-09-0305:15:32maxarena.com.au
2014-09-0305:15:32artonglass.com.au
2014-09-0305:15:32jordangraufdesign.com.au
2014-09-0305:15:32moorookafdc.com.au
2014-09-0305:15:33clapham.id.au
2014-09-0305:15:37ozwholesale.net.au
2014-09-0305:15:37farmtoyou.net.au
2014-09-0305:15:38islamiccentrewa.org.au
2014-09-0305:25:31alisonandrews.com.au
2014-09-0305:25:31oztensmachine.com.au
2014-09-0305:25:31thismodernlife.com.au
2014-09-0305:25:31seaspirit.com.au
2014-09-0305:25:31glenbrookwines.com.au
2014-09-0305:25:31locallyhosted.com.au
2014-09-0305:25:31sustainabilityenvironment.com.au
2014-09-0305:25:31foodandwineevent.com.au
2014-09-0305:25:31criticalimpact.com.au
2014-09-0305:25:31sdsarchitects.com.au
2014-09-0305:25:31oztensmachines.com.au
2014-09-0305:25:31winefoodfestival.com.au
2014-09-0305:25:36eventsmanagement.net.au
2014-09-0305:25:37decisionmakers.net.au
2014-09-0305:25:37eventmanagementsydney.net.au
2014-09-0305:25:37anthonyberbari.net.au
2014-09-0305:25:37eventsmanager.net.au
2014-09-0305:25:38cert.org.au
2014-09-0305:35:31thewebrecruiter.com.au
2014-09-0305:35:31travelgorilla.com.au
2014-09-0305:35:31dryshoes.com.au
2014-09-0305:35:31miedg.com.au
2014-09-0305:35:31metrostyletiles.com.au
2014-09-0305:35:31killingfloor.com.au
2014-09-0305:35:314x2win.com.au
2014-09-0305:35:31dryboots.com.au
2014-09-0305:35:31vanemmerikandassociates.com.au
2014-09-0305:35:31sydney2025.com.au
2014-09-0305:35:31mysticlounge.com.au
2014-09-0305:35:32mouthing.com.au
2014-09-0305:35:32sydney2015.com.au
2014-09-0305:35:32thekillingfloor.com.au
2014-09-0305:35:32latinhubkids.com.au
2014-09-0305:35:32cognisense.com.au
2014-09-0305:35:32sydney2020.com.au
2014-09-0305:35:32vividvillage.com.au
2014-09-0305:35:37miedg.net.au
2014-09-0305:35:374x2win.net.au
2014-09-0305:45:00foodservice.asn.au
2014-09-0305:45:31regenerative.com.au
2014-09-0305:45:31ledvn.com.au
2014-09-0305:45:31nicegiftforeveryone.com.au
2014-09-0305:45:31joven.com.au
2014-09-0305:45:32scootgraphics.com.au
2014-09-0305:45:32roseydomesticcleaning.com.au
2014-09-0305:45:32manvalite.com.au
2014-09-0305:45:32brandedbabes.com.au
2014-09-0305:45:32digitaldoo.com.au
2014-09-0305:45:32sojam.com.au
2014-09-0305:45:32transformationplastering.com.au
2014-09-0305:45:32bestphotographerinsydney.com.au
2014-09-0305:45:32inphoto.com.au
2014-09-0305:45:32nasha.com.au
2014-09-0305:45:32attivoinfo.com.au
2014-09-0305:45:37heartrisk.net.au
2014-09-0305:45:37hutchinsons.net.au
2014-09-0305:55:31steelcapskincare.com.au
2014-09-0305:55:31force4.com.au
2014-09-0305:55:31perfectserum.com.au
2014-09-0305:55:31svcf.com.au
2014-09-0305:55:31forcefour.com.au
2014-09-0305:55:31reelreview.com.au
2014-09-0305:55:32buygolfonline.com.au
2014-09-0305:55:32tshirtprintingforyou.com.au
2014-09-0305:55:32metalsplanet.com.au
2014-09-0305:55:32perfectserums.com.au
2014-09-0305:55:32twsteelwatches.com.au
2014-09-0305:55:37distressspace.net.au
2014-09-0305:55:37powerhousepro.net.au
2014-09-0306:05:32allrubbishremoved.com.au
2014-09-0306:05:32welease.com.au
2014-09-0306:05:32thaitreasures.com.au
2014-09-0306:05:32skyboards.com.au
2014-09-0306:05:32thenatury.com.au
2014-09-0306:05:32forcefor.com.au
2014-09-0306:05:32mowinglawnssydney.com.au
2014-09-0306:05:32compensationhelpline.com.au
2014-09-0306:05:32e-advise.com.au
2014-09-0306:05:32golspiewindfarm.com.au
2014-09-0306:05:32giftnote.com.au
2014-09-0306:05:32theluxure.com.au
2014-09-0306:05:37sydneyofficecleaners.net.au
2014-09-0306:05:37sydneycleaning.net.au
2014-09-0306:05:37removalrubbish.net.au
2014-09-0306:05:37unitedstatesofamerica.net.au
2014-09-0306:05:37byronbayyoga.net.au
2014-09-0306:15:31ilovehalloween.com.au
2014-09-0306:15:31eliteprp.com.au
2014-09-0306:15:31brandkraft.com.au
2014-09-0306:15:31justpots.com.au
2014-09-0306:15:31elitestemcells.com.au
2014-09-0306:15:31greenvillereception.com.au
2014-09-0306:15:31chekelectrical.com.au
2014-09-0306:15:31ixiarose.com.au
2014-09-0306:15:31mullumbimbyyoga.com.au
2014-09-0306:15:31lifestyle4ufurniture.com.au
2014-09-0306:15:31thestemcellinstitute.com.au
2014-09-0306:15:31art-illustration.com.au
2014-09-0306:15:31yogamullumbimby.com.au
2014-09-0306:15:31clickdotcom.com.au
2014-09-0306:15:36yogabyronbay.net.au
2014-09-0306:15:36tritecgroup.net.au
2014-09-0306:15:37lisabaker.org.au
2014-09-0306:25:31corporatedinosaurs.com.au
2014-09-0306:25:31organisethechaos.com.au
2014-09-0306:25:31pointlonsdalebeachhouse.com.au
2014-09-0306:25:31outofthebluechoir.com.au
2014-09-0306:25:31powerofthepeople.com.au
2014-09-0306:25:31homeaffairs.com.au
2014-09-0306:25:31smsbuddy.com.au
2014-09-0306:25:32smallacreageservices.com.au
2014-09-0306:25:32thinkgiftideas.com.au
2014-09-0306:25:32pjrentertainment.com.au
2014-09-0306:25:32vitallight.com.au
2014-09-0306:25:32buzztel.com.au
2014-09-0306:25:32computernut.com.au
2014-09-0306:25:32puresocial.com.au
2014-09-0306:25:32googleplex.com.au
2014-09-0306:25:32photographybytreasurepics.com.au
2014-09-0306:25:37vitallight.net.au
2014-09-0306:25:37buzztel.net.au
2014-09-0306:25:37pointlonsdalebeachhouse.net.au
2014-09-0306:25:38senmurdoch.org.au
2014-09-0306:35:31idotoo.com.au
2014-09-0306:35:32gettothepoint.com.au
2014-09-0306:35:32harrisonfilmandmedia.com.au
2014-09-0306:35:32kinematicanalysis.com.au
2014-09-0306:35:32paperandbeads.com.au
2014-09-0306:35:32buffetmedia.com.au
2014-09-0306:35:32linearanalysis.com.au
2014-09-0306:35:32computersimulation.com.au
2014-09-0306:35:32discreteelementmethods.com.au
2014-09-0306:35:32nonlinearanalysis.com.au
2014-09-0306:35:32byebyesti.com.au
2014-09-0306:35:32zwsoft.com.au
2014-09-0306:35:32brainwire.com.au
2014-09-0306:35:32patran.com.au
2014-09-0306:35:33finiteelement.com.au
2014-09-0306:35:33thecovertcook.com.au
2014-09-0306:35:33xflow.com.au
2014-09-0306:35:33adaptarch.com.au
2014-09-0306:35:38computeraidedengineering.net.au
2014-09-0306:35:38rockabye.net.au
2014-09-0306:35:38engineeringsimulation.net.au
2014-09-0306:35:38computersimulation.net.au
2014-09-0306:35:38finiteelement.net.au
2014-09-0306:35:38exmouthconstructionservices.net.au
2014-09-0306:45:31sadlersnursery.com.au
2014-09-0306:45:31werribeeplazabingo.com.au
2014-09-0306:45:31holdmyhand.com.au
2014-09-0306:45:31sms2call.com.au
2014-09-0306:45:32chiefdev.com.au
2014-09-0306:45:32briopreparedmeals.com.au
2014-09-0306:45:32teepod.com.au
2014-09-0306:45:32diplomamanagementcourses.com.au
2014-09-0306:45:32briohealth.com.au
2014-09-0306:45:32managementdiplomacourses.com.au
2014-09-0306:45:32attinisoftware.com.au
2014-09-0306:45:32pjscoffee.com.au
2014-09-0306:45:32thecakepopfactoryonline.com.au
2014-09-0306:45:32trakabear.com.au
2014-09-0306:45:32schoolofknowledge.com.au
2014-09-0306:45:32jbslegalaccountsolutions.com.au
2014-09-0306:45:32coursesofmanagement.com.au
2014-09-0306:45:32briohealthymeals.com.au
2014-09-0306:45:32allstarcarsales.com.au
2014-09-0306:45:32londonperfumeshop.com.au
2014-09-0306:45:32briohealthyfood.com.au
2014-09-0306:45:32peachtheatrecompany.com.au
2014-09-0306:45:32emtjobs.com.au
2014-09-0306:45:33whatisoninbrisbane.com.au
2014-09-0306:45:33everythingbyronbay.com.au
2014-09-0306:45:33text2call.com.au
2014-09-0306:45:33earthmovinggear.com.au
2014-09-0306:45:33mininggear.com.au
2014-09-0306:45:33briolife.com.au
2014-09-0306:45:33governmentfundedcoursesmelbourne.com.au
2014-09-0306:45:33noosaparkresort.com.au
2014-09-0306:45:33briofoods.com.au
2014-09-0306:45:33systemfloorsanding.com.au
2014-09-0306:45:33txt2call.com.au
2014-09-0306:45:33stratait.com.au
2014-09-0306:45:33brioaustralia.com.au
2014-09-0306:45:33hallfb.com.au
2014-09-0306:45:33sosrealestate.com.au
2014-09-0306:45:33sadlerlandscaping.com.au
2014-09-0306:45:33holdenoffer.com.au
2014-09-0306:45:33fitnessmanagementcourses.com.au
2014-09-0306:45:33holdenoffers.com.au
2014-09-0306:45:39brio.net.au
2014-09-0306:55:31erskinevilleapartment.com.au
2014-09-0306:55:31katrinagibsonbeautytherapies.com.au
2014-09-0306:55:31courseinmanagement.com.au
2014-09-0306:55:31onlinehardwareshop.com.au
2014-09-0306:55:31madformassage.com.au
2014-09-0306:55:31megacoaching.com.au
2014-09-0306:55:32theinteriortrader.com.au
2014-09-0306:55:32bpelectrics.com.au
2014-09-0306:55:32prima-medical.com.au
2014-09-0306:55:32alphacrucisonlinestore.com.au
2014-09-0306:55:32grumpyoldwoman.com.au
2014-09-0306:55:32vividstickers.com.au
2014-09-0306:55:32genfuture.com.au
2014-09-0306:55:38meatdirect.net.au
2014-09-0307:05:31brunchcafe.com.au
2014-09-0307:05:31paulsautomotives.com.au
2014-09-0307:05:31oncallinterpreters.com.au
2014-09-0307:05:31themoderndaypriestess.com.au
2014-09-0307:05:31footorthoticscranbourne.com.au
2014-09-0307:05:31rideforrostrevor.com.au
2014-09-0307:05:31atlanti-kayaks.com.au
2014-09-0307:05:31smileandwalk4ellie.com.au
2014-09-0307:05:32riversofemotion.com.au
2014-09-0307:05:32walk4ellie.com.au
2014-09-0307:05:32homeloanmeme.com.au
2014-09-0307:05:32firsthomebuyermeme.com.au
2014-09-0307:05:32nelaconference.com.au
2014-09-0307:05:32creditcardmeme.com.au
2014-09-0307:05:32mattressescranbourne.com.au
2014-09-0307:05:37bbdesign.net.au
2014-09-0307:05:38bundabergpcyc.org.au
2014-09-0307:05:38bundypcyc.org.au
2014-09-0307:15:31touchupcafe.com.au
2014-09-0307:15:32bobcatandtipperhire.com.au
2014-09-0307:15:32lebrocquecapital.com.au
2014-09-0307:15:32jazindigo.com.au
2014-09-0307:15:32frankieandstella.com.au
2014-09-0307:15:32cdpventilation.com.au
2014-09-0307:15:32aardvarkdesign.com.au
2014-09-0307:15:32eternalbloom.com.au
2014-09-0307:15:32voyagersenses.com.au
2014-09-0307:15:32mlhcarpentry.com.au
2014-09-0307:15:32protourgolf.com.au
2014-09-0307:15:32excavatorandtipperhire.com.au
2014-09-0307:15:32beachbodyforlife.com.au
2014-09-0307:15:32howiwear.com.au
2014-09-0307:15:33nbathletics.com.au
2014-09-0307:15:33travaddict.com.au
2014-09-0307:15:33lebrocque.com.au
2014-09-0307:15:33parksidepreschool.com.au
2014-09-0307:15:38frankieandstella.net.au
2014-09-0307:25:31whisperingtreegallery.com.au
2014-09-0307:25:31flpa.com.au
2014-09-0307:25:31bobcat-hire-melbourne.com.au
2014-09-0307:25:31marcwithnall.com.au
2014-09-0307:25:31flpaactar.com.au
2014-09-0307:25:31myremarkablejourneys.com.au
2014-09-0307:25:31flpacar.com.au
2014-09-0307:25:31escapeministries.com.au
2014-09-0307:25:31idylliccaravans.com.au
2014-09-0307:25:31limetreehome.com.au
2014-09-0307:25:31churchstuff.com.au
2014-09-0307:25:31bulliedbuddys.com.au
2014-09-0307:25:32onesuitcase.com.au
2014-09-0307:25:32flpaact.com.au
2014-09-0307:25:32flpacanberra.com.au
2014-09-0307:25:32blockersroad.com.au
2014-09-0307:25:37somersethill.net.au
2014-09-0307:25:37customwoodcrafting.net.au
2014-09-0307:35:30tonynathan.com.au
2014-09-0307:35:30perfectsleepaustralia.com.au
2014-09-0307:35:30fiftyshadesadultstore.com.au
2014-09-0307:35:30rockhamptongigguide.com.au
2014-09-0307:35:30snapbargains.com.au
2014-09-0307:35:30werbatteries.com.au
2014-09-0307:35:30gladstonegigguide.com.au
2014-09-0307:35:30bibblebubble.com.au
2014-09-0307:35:30taichihurstville.com.au
2014-09-0307:35:30australianmegafaunacentre.com.au
2014-09-0307:35:30taichikogarah.com.au
2014-09-0307:35:30getmaw.com.au
2014-09-0307:35:30margaretrivermegafauna.com.au
2014-09-0307:35:30lunchcity.com.au
2014-09-0307:35:30capitalautoupholstery.com.au
2014-09-0307:35:31taichistgeorge.com.au
2014-09-0307:35:31craigwalton.com.au
2014-09-0307:35:36fiftyshadesadultstore.net.au
2014-09-0307:35:36getmaw.net.au
2014-09-0307:45:31busseltoncleaning.com.au
2014-09-0307:45:31cleaningsouthwest.com.au
2014-09-0307:45:31decorlicous.com.au
2014-09-0307:45:31angusestatefurniture.com.au
2014-09-0307:45:31cleaningdunsborough.com.au
2014-09-0307:45:31stonepropertydevelopments.com.au
2014-09-0307:45:31impresscafe.com.au
2014-09-0307:45:31mawcouture.com.au
2014-09-0307:45:32socialmediaprofitstrategist.com.au
2014-09-0307:45:32nvppromotions.com.au
2014-09-0307:45:32cgfloor.com.au
2014-09-0307:45:32sydneynlp1.com.au
2014-09-0307:45:32holidayhomessouthwest.com.au
2014-09-0307:45:37ultimate30.net.au
2014-09-0307:45:37socialmediaprofitstrategist.net.au
2014-09-0307:55:31cawthornefisheries.com.au
2014-09-0307:55:31debtorconnect.com.au
2014-09-0307:55:31karliqueforhair.com.au
2014-09-0307:55:31yallingupcleaning.com.au
2014-09-0307:55:31naturalisteholidayhomes.com.au
2014-09-0307:55:31littlemisshowto.com.au
2014-09-0307:55:31quickseo.com.au
2014-09-0307:55:31cleaningbusselton.com.au
2014-09-0307:55:31jewishfilmfoundationofaustralia.com.au
2014-09-0307:55:31freshprep.com.au
2014-09-0307:55:31cleaningyallingup.com.au
2014-09-0307:55:31thegozitan.com.au
2014-09-0307:55:31southwestcleaning.com.au
2014-09-0307:55:37penis-extender.net.au
2014-09-0307:55:37micksplastering.net.au
2014-09-0307:55:38corangamiteklickers.org.au
2014-09-0308:05:31tweedcoastrealestate.com.au
2014-09-0308:05:31petersonenterprises.com.au
2014-09-0308:05:31doitpromaint.com.au
2014-09-0308:05:31penis-extender.com.au
2014-09-0308:05:31babypetite.com.au
2014-09-0308:05:31brickiez.com.au
2014-09-0308:05:31penisenlargement-info.com.au
2014-09-0308:05:36fingalrealestate.net.au
2014-09-0308:05:37terranorarealestate.net.au
2014-09-0308:05:37penisenlargement-info.net.au
2014-09-0308:05:37tweedheadsrealestate.net.au
2014-09-0308:05:37saltrealestate.net.au
2014-09-0308:05:37penisenlargementinfo.net.au
2014-09-0308:05:37cabaritarealestate.net.au
2014-09-0308:05:37pottsvillerealestate.net.au
2014-09-0308:05:37bilambilrealestate.net.au
2014-09-0308:05:37casuarinarealestate.net.au
2014-09-0308:05:37banorapointrealestate.net.au
2014-09-0308:15:31australiaweld.com.au
2014-09-0308:15:31remotegaspower.com.au
2014-09-0308:15:31smartachiever.com.au
2014-09-0308:15:31vlocal.com.au
2014-09-0308:15:31actforeducation.com.au
2014-09-0308:15:31almostvegas.com.au
2014-09-0308:15:31remotedieselpower.com.au
2014-09-0308:15:31dieselgenset.com.au
2014-09-0308:15:31finertouches.com.au
2014-09-0308:15:31dieselpowerstation.com.au
2014-09-0308:15:31electricdeliveryscooter.com.au
2014-09-0308:15:32gasgenset.com.au
2014-09-0308:15:32grumpypig.com.au
2014-09-0308:15:32ledlightingenvirolife.com.au
2014-09-0308:15:37kingscliffrealestate.net.au
2014-09-0308:15:37skillsmaintenance.net.au
2014-09-0308:25:31ausbill.com.au
2014-09-0308:25:31dialoseal.com.au
2014-09-0308:25:32argusip.com.au
2014-09-0308:25:32reddragoncreations.com.au
2014-09-0308:25:32postcode6000.com.au
2014-09-0308:25:32hairsurgery.com.au
2014-09-0308:25:32bosnichhairtransplant.com.au
2014-09-0308:25:32hairtransplantnewin.com.au
2014-09-0308:25:32hairsurgerymelbourne.com.au
2014-09-0308:25:32tripmunk.com.au
2014-09-0308:25:32kyillajostud.com.au
2014-09-0308:25:37ausbill.net.au
2014-09-0308:25:37argusip.net.au
2014-09-0308:35:31languageline.com.au
2014-09-0308:35:31thehrpractice.com.au
2014-09-0308:35:31dogbook.com.au
2014-09-0308:35:32patchaholics.com.au
2014-09-0308:35:32huntandhair.com.au
2014-09-0308:35:32fi-glass.com.au
2014-09-0308:45:30spadeandspoon.com.au
2014-09-0308:45:30cooperconstruction.com.au
2014-09-0308:45:30hndservices.com.au
2014-09-0308:45:30yourwishisyourcommand.com.au
2014-09-0308:45:30adrenalizehealth.com.au
2014-09-0308:45:31swaddlestrap.com.au
2014-09-0308:45:31globifone.com.au
2014-09-0308:45:31beadlady.com.au
2014-09-0308:45:31ravewear.com.au
2014-09-0308:45:31mhahs.com.au
2014-09-0308:45:31room48.com.au
2014-09-0308:55:31penis-enlargement-review.com.au
2014-09-0308:55:31adirimports.com.au
2014-09-0308:55:31saucecafe.com.au
2014-09-0308:55:31spotonconstruction.com.au
2014-09-0308:55:32penisextenderinfo.com.au
2014-09-0308:55:32hondamotorcyclespartsonline.com.au
2014-09-0308:55:32spinalandsportschiropractic.com.au
2014-09-0308:55:32penis-extender-review.com.au
2014-09-0308:55:32briggspartsonline.com.au
2014-09-0308:55:32regentglass.com.au
2014-09-0308:55:37penisenlarger.net.au
2014-09-0308:55:37penisextender.net.au
2014-09-0308:55:37yummietummie.net.au
2014-09-0308:55:37penisextenderinfo.net.au
2014-09-0308:55:37penis-extender-review.net.au
2014-09-0309:05:30tfspropertyinvestor.com.au
2014-09-0309:05:30sellyourideas.com.au
2014-09-0309:05:31victoriaterrace.com.au
2014-09-0309:05:31melitapastries.com.au
2014-09-0309:05:31boxaus.com.au
2014-09-0309:05:31yamahapartsonline.com.au
2014-09-0309:05:31ecomcommodities.com.au
2014-09-0309:05:31kawasakipartsonline.com.au
2014-09-0309:05:31airportlockupcarstorage.com.au
2014-09-0309:05:31brisbanebabymassage.com.au
2014-09-0309:05:31lockupcarstoarge.com.au
2014-09-0309:05:31brisbaneinfantmassage.com.au
2014-09-0309:05:31sunshinecoastbabymassage.com.au
2014-09-0309:05:31briggsandstrattonpartsonline.com.au
2014-09-0309:05:31suzukipartsonline.com.au
2014-09-0309:05:31mdconnective.com.au
2014-09-0309:05:31prestigeundercoverparking.com.au
2014-09-0309:05:31ecomcotton.com.au
2014-09-0309:05:31youniversalproducts.com.au
2014-09-0309:05:31buyultrasound.com.au
2014-09-0309:05:31sunshinecoastinfantmassage.com.au
2014-09-0309:05:31thejewelstore.com.au
2014-09-0309:05:37annaturnerweddings.net.au
2014-09-0309:15:31jimsmobilecarwash.com.au
2014-09-0309:15:31thermagen.com.au
2014-09-0309:15:31ecomtrading.com.au
2014-09-0309:15:31saveourspit.com.au
2014-09-0309:15:31sportsgrabs.com.au
2014-09-0309:15:31rockineventmanagement.com.au
2014-09-0309:15:31sportgrabs.com.au
2014-09-0309:15:31theworkingmumscoach.com.au
2014-09-0309:15:31yogamom.com.au
2014-09-0309:15:31sportgrab.com.au
2014-09-0309:15:31serendipitycakecouture.com.au
2014-09-0309:15:36golddealers.net.au
2014-09-0309:15:36sportsgrab.net.au
2014-09-0309:15:36saveourspit.net.au
2014-09-0309:15:36sportsgrabs.net.au
2014-09-0309:15:36sportgrabs.net.au
2014-09-0309:15:36jimsmobilecarwash.net.au
2014-09-0309:15:36sportgrab.net.au
2014-09-0309:25:30therenovationplanners.com.au
2014-09-0309:25:30theprintdoctor.com.au
2014-09-0309:25:30theprintdr.com.au
2014-09-0309:25:30phoenixlibrary.com.au
2014-09-0309:25:31rivercitymedicalphysics.com.au
2014-09-0309:25:31tradiescommercial.com.au
2014-09-0309:25:31whymencheat.com.au
2014-09-0309:25:31tradieshome.com.au
2014-09-0309:25:31futureoflearningconference.com.au
2014-09-0309:25:36greenhalo.net.au
2014-09-0309:25:36theprintdoctor.net.au
2014-09-0309:25:36theprintdr.net.au
2014-09-0309:35:31plcg.com.au
2014-09-0309:35:31asteksales.com.au
2014-09-0309:35:31thefishreport.com.au
2014-09-0309:35:31readitwinit.com.au
2014-09-0309:35:31pidplates.com.au
2014-09-0309:35:31mappability.com.au
2014-09-0309:35:31nakedape.com.au
2014-09-0309:35:31allsexwa.com.au
2014-09-0309:35:31xerocarbon.com.au
2014-09-0309:35:31wagsntails.com.au
2014-09-0309:35:31businesssafety.com.au
2014-09-0309:35:36xerocarbon.net.au
2014-09-0309:35:36allsexwa.net.au
2014-09-0309:45:32weewaahwaah.com.au
2014-09-0309:45:32theheadspace.com.au
2014-09-0309:45:32littleredtuktuk.com.au
2014-09-0309:45:37theheadspace.net.au
2014-09-0309:55:31pixtoprint.com.au
2014-09-0309:55:31westsouthwest.com.au
2014-09-0309:55:31christinacelebrant.com.au
2014-09-0309:55:31muslimevents.com.au
2014-09-0309:55:31optimiseandmaximise.com.au
2014-09-0309:55:31tylarose.com.au
2014-09-0309:55:31viva9.com.au
2014-09-0309:55:31advancedmediasolutions.com.au
2014-09-0309:55:31ultrasonicclinic.com.au
2014-09-0309:55:31businesssearchready.com.au
2014-09-0309:55:32mcgroryinteriors.com.au
2014-09-0309:55:32anytimeloans.com.au
2014-09-0309:55:32bready.com.au
2014-09-0309:55:32gofundit.com.au
2014-09-0310:05:30bella-escorts.com.au
2014-09-0310:05:30epowerlink.com.au
2014-09-0310:05:30pushmaternity.com.au
2014-09-0310:05:30exonra.com.au
2014-09-0310:05:304b2.com.au
2014-09-0310:05:30intuitivecoach.com.au
2014-09-0310:05:30panjeerifoods.com.au
2014-09-0310:05:30developingintuition.com.au
2014-09-0310:05:304b2constructions.com.au
2014-09-0310:05:30rockitconstructions.com.au
2014-09-0310:05:36adelaideled.net.au
2014-09-0310:15:29ozzyrpm.com.au
2014-09-0310:15:29bouncybib.com.au
2014-09-0310:15:29nflbets.com.au
2014-09-0310:15:29spino.com.au
2014-09-0310:15:29yvettefitzpatrickphotography.com.au
2014-09-0310:15:29bouncingsprout.com.au
2014-09-0310:15:29wittypinion.com.au
2014-09-0310:15:30yvettefitzpatrick.com.au
2014-09-0310:15:30indulgentsweets.com.au
2014-09-0310:15:30myweightlosscoach.com.au
2014-09-0310:15:30bouncybibs.com.au
2014-09-0310:15:30serioussparklers.com.au
2014-09-0310:15:30holisticcounsellingservices.com.au
2014-09-0310:15:30thegorgeousgardener.com.au
2014-09-0310:15:34springcarnivalbet.net.au
2014-09-0310:15:35springcarnivalracing.net.au
2014-09-0310:15:35drlaithbarnouti.net.au
2014-09-0310:25:29ultimatemmaexpo.com.au
2014-09-0310:25:29betforfun.com.au
2014-09-0310:25:34bettingwebsite.net.au
2014-09-0310:25:34springcarnivalbetting.net.au
2014-09-0310:35:30todaymanagement.com.au
2014-09-0310:35:30motorhomemelbourne.com.au
2014-09-0310:35:30katmikic.com.au
2014-09-0310:35:30katarinamikic.com.au
2014-09-0310:35:35youthfulageing.net.au
2014-09-0310:35:35vantagecontrols.net.au
2014-09-0310:35:35babycare.net.au
2014-09-0310:35:35tweedcoastrealestate.net.au
2014-09-0310:45:31thetahealingtasmania.com.au
2014-09-0310:45:31erachedesigns.com.au
2014-09-0310:45:31kafic.com.au
2014-09-0310:45:31roymorganfinance.com.au
2014-09-0310:45:32aldontutoringcarina.com.au
2014-09-0310:45:32freedombusinesssolutions.com.au
2014-09-0310:45:32missionmedia.com.au
2014-09-0310:45:32imageconsultantperth.com.au
2014-09-0310:45:37cfe.net.au
2014-09-0310:45:37eaglesnestcottage.net.au
2014-09-0310:45:37aussieliquor.net.au
2014-09-0310:55:30buttblast.com.au
2014-09-0310:55:30localsuperspecials.com.au
2014-09-0310:55:30macaronboutique.com.au
2014-09-0310:55:30athomebusinesses.com.au
2014-09-0310:55:30localsuperspecial.com.au
2014-09-0310:55:30tfcdesigns.com.au
2014-09-0310:55:30worldlink.com.au
2014-09-0311:05:31sydney-printing.com.au
2014-09-0311:05:31stairchairlifts.com.au
2014-09-0311:05:31queenslandstairlifts.com.au
2014-09-0311:05:31stairliftsqueensland.com.au
2014-09-0311:05:31markandnatalie.com.au
2014-09-0311:05:31stairliftinstallations.com.au
2014-09-0311:05:31brisbanestairlifts.com.au
2014-09-0311:05:31reflectatag.com.au
2014-09-0311:05:31magnetfreight.com.au
2014-09-0311:05:31flashhandcarwash.com.au
2014-09-0311:05:31merchantofeast.com.au
2014-09-0311:05:31numihealth.com.au
2014-09-0311:05:31elitetilingservices.com.au
2014-09-0311:05:36diggit.net.au
2014-09-0311:05:36123layby.net.au
2014-09-0311:15:32incredi.com.au
2014-09-0311:15:32welcomecommittee.com.au
2014-09-0311:15:32techfix.com.au
2014-09-0311:15:32diavolina.com.au
2014-09-0311:15:32houseboatbookings.com.au
2014-09-0311:15:32caputienterprises.com.au
2014-09-0311:15:32rainbowgypsylala.com.au
2014-09-0311:15:33safeguardconsulting.com.au
2014-09-0311:15:37safeguardconsulting.net.au
2014-09-0311:35:29jelproperty.com.au
2014-09-0311:55:31itimaeus.com.au
2014-09-0311:55:31bcpgo.com.au
2014-09-0311:55:31rainbowpaws.com.au
2014-09-0311:55:31cherryandseed.com.au
2014-09-0311:55:31fromtheair.com.au
2014-09-0311:55:31commercialforsaleorlease.com.au
2014-09-0311:55:31hiveculture.com.au
2014-09-0311:55:31puntbuddy.com.au
2014-09-0311:55:32ouibit.com.au
2014-09-0311:55:32professionalwritingservices.com.au
2014-09-0312:05:30retailforsale.com.au
2014-09-0312:05:30fractalsoftworks.com.au
2014-09-0312:05:30inspired-clothing-accessories.com.au
2014-09-0312:15:31deadseacosmetics.com.au
2014-09-0312:15:31espressoentourage.com.au
2014-09-0312:15:31bittersuitecafe.com.au
2014-09-0312:15:31andrex.com.au
2014-09-0312:15:37youngeryou.net.au
2014-09-0312:25:31ronny22.com.au
2014-09-0312:25:31cafedicasa.com.au
2014-09-0312:25:31geoff-finlay.com.au
2014-09-0312:25:31bostoncitycampusandbusinesscollege.com.au
2014-09-0312:25:31getanidea.com.au
2014-09-0312:25:31compostcup.com.au
2014-09-0312:25:31chookmarks.com.au
2014-09-0312:25:31carrumdownsfirebrigade.com.au
2014-09-0312:25:37centralcoastbatteries.net.au
2014-09-0312:25:37melbournebathrooms.net.au
2014-09-0312:25:37glamhair.net.au
2014-09-0312:35:31technicianplus.com.au
2014-09-0312:35:31ccward.com.au
2014-09-0312:35:31mylittlepillowprayerbook.com.au
2014-09-0312:35:31recordagogo.com.au
2014-09-0312:35:32mensdeli.com.au
2014-09-0312:35:32dadsdeli.com.au
2014-09-0312:35:32beauticell.com.au
2014-09-0312:35:32webuybusinesses.com.au
2014-09-0312:35:32diypest.com.au
2014-09-0312:35:32meinclusion.com.au
2014-09-0312:35:32mumsdeli.com.au
2014-09-0312:35:32poledanceproteinshake.com.au
2014-09-0312:35:32petsnaturally.com.au
2014-09-0312:35:32skydomain.com.au
2014-09-0312:35:32explorershq.com.au
2014-09-0312:35:32vapersdelight.com.au
2014-09-0312:35:32victa7.com.au
2014-09-0312:45:31prestigerestorations.com.au
2014-09-0312:45:31executivecareerstep.com.au
2014-09-0312:45:31northernriversbilliardstables.com.au
2014-09-0312:45:31webinow.com.au
2014-09-0312:45:31executivecareersteps.com.au
2014-09-0312:45:31setforart.com.au
2014-09-0312:45:31propitc.com.au
2014-09-0312:45:31conjurersonline.com.au
2014-09-0312:45:31firstclasschildcareandhousekeepingservices.com.au
2014-09-0312:45:31prebuildsolutions.com.au
2014-09-0312:45:31genuinewealthcreator.com.au
2014-09-0312:45:37diamondweddingring.net.au
2014-09-0312:45:37executivecareerstep.net.au
2014-09-0312:45:37diamondengagementring.net.au
2014-09-0312:45:37executivecareersteps.net.au
2014-09-0312:55:32dunriteelectrical.com.au
2014-09-0312:55:32uscanme.com.au
2014-09-0312:55:32crsolutionsindrafting.com.au
2014-09-0312:55:32findexecutives.com.au
2014-09-0312:55:32koslex-steamspa.com.au
2014-09-0312:55:325plus.com.au
2014-09-0312:55:32koslex-fluidchillersaustralia.com.au
2014-09-0312:55:32soulsista.com.au
2014-09-0312:55:32preciousimagephotography.com.au
2014-09-0312:55:32ppc-expert.com.au
2014-09-0312:55:32funtimeparties2u.com.au
2014-09-0312:55:32billabongturffarm.com.au
2014-09-0312:55:33koslex-customfibreglass.com.au
2014-09-0312:55:33trga.com.au
2014-09-0312:55:33partneredbusinesssolutions.com.au
2014-09-0312:55:38findexecutives.net.au
2014-09-0312:55:38whf.net.au
2014-09-0312:55:38trga.net.au
2014-09-0312:55:38findexecutive.net.au
2014-09-0312:55:38findexec.net.au
2014-09-0313:05:32coachingcorner.com.au
2014-09-0313:05:32koslex-aquatic.com.au
2014-09-0313:05:32execcareers.com.au
2014-09-0313:05:32execcareerstep.com.au
2014-09-0313:05:32teastotantalise.com.au
2014-09-0313:05:32tamworthtech.com.au
2014-09-0313:05:32teastotantalize.com.au
2014-09-0313:05:32superpawer.com.au
2014-09-0313:05:32anywatersports.com.au
2014-09-0313:05:32thecoffeemugs.com.au
2014-09-0313:05:32designwithmilescanning.com.au
2014-09-0313:05:32execcareersteps.com.au
2014-09-0313:05:32magicalcupncakes.com.au
2014-09-0313:05:32alivenow.com.au
2014-09-0313:05:32vividcommunications.com.au
2014-09-0313:05:37alivenow.net.au
2014-09-0313:05:37irobot.net.au
2014-09-0313:05:37execcareersteps.net.au
2014-09-0313:05:37execcareerstep.net.au
2014-09-0313:05:38execcareers.net.au
2014-09-0313:15:32iguanagraphics.com.au
2014-09-0313:15:32photogearsonline.com.au
2014-09-0313:15:32startupjobs.com.au
2014-09-0313:15:32cadenceyourmove.com.au
2014-09-0313:15:32wildadults.com.au
2014-09-0313:15:32swanbaytrade.com.au
2014-09-0313:15:32inspiredvisionfoundation.com.au
2014-09-0313:15:32mobiletop10.com.au
2014-09-0313:15:32theriftbowral.com.au
2014-09-0313:15:32pregnancyduedate.com.au
2014-09-0313:15:32mobiletopten.com.au
2014-09-0313:15:32annataranto.com.au
2014-09-0313:15:32thecoachhouse.com.au
2014-09-0313:15:32theriftretreat.com.au
2014-09-0313:15:32cupcakesinabox.com.au
2014-09-0313:15:37macdonaldshaw.net.au
2014-09-0313:15:37cadenceyourmove.net.au
2014-09-0313:15:37cadencepeople.net.au
2014-09-0313:25:31airobuilding.com.au
2014-09-0313:25:31bassformwork.com.au
2014-09-0313:25:31century21wentworth.com.au
2014-09-0313:25:31sem-dynamics.com.au
2014-09-0313:25:31dreamway.com.au
2014-09-0313:25:31heatersaustralia.com.au
2014-09-0313:35:30infinitehair.com.au
2014-09-0313:35:30aifinance.com.au
2014-09-0313:35:30inhomecookingclass.com.au
2014-09-0313:35:31myofficeapps.com.au
2014-09-0313:35:31handmadevintagekustoms.com.au
2014-09-0313:35:31asiawide.com.au
2014-09-0313:35:31parkerjames.com.au
2014-09-0313:35:31joallie.com.au
2014-09-0313:35:31wowservices.com.au
2014-09-0313:35:31wowsystem.com.au
2014-09-0313:35:36reebok.net.au
2014-09-0313:35:36adidas.net.au
2014-09-0313:35:36joallie.net.au
2014-09-0313:45:32doneforyouseo.com.au
2014-09-0313:45:32doneforyoulocalbusiness.com.au
2014-09-0313:45:32doneforyoulocalmarketing.com.au
2014-09-0313:45:32doneforyousocialmedia.com.au
2014-09-0313:45:32microsoftitacademy.com.au
2014-09-0313:45:32fitnessreligion.com.au
2014-09-0313:45:32doneforyousmallbusiness.com.au
2014-09-0313:45:32marmas.com.au
2014-09-0313:45:32doneforyoubusiness.com.au
2014-09-0313:45:37marmas.net.au
2014-09-0313:45:37doneforyoulocalmarketing.net.au
2014-09-0313:45:37doneforyousocialmedia.net.au
2014-09-0313:45:37doneforyoulocalbusiness.net.au
2014-09-0313:45:37doneforyoubusiness.net.au
2014-09-0313:45:37doneforyouseo.net.au
2014-09-0313:45:37doneforyousmallbusiness.net.au
2014-09-0313:55:31eminencecardetailing.com.au
2014-09-0313:55:31canberrawatertanks.com.au
2014-09-0313:55:31bodystrong.com.au
2014-09-0313:55:31hotchiptrailer.com.au
2014-09-0313:55:31glazingsydney.com.au
2014-09-0313:55:32adelaidewatertanks.com.au
2014-09-0313:55:32heartfeltstyling.com.au
2014-09-0313:55:32katiebrennan.com.au
2014-09-0313:55:32bsaclub.com.au
2014-09-0314:05:32ezymobility.com.au
2014-09-0314:05:32melbourneclinicalpsychologygroup.com.au
2014-09-0314:05:32homeloanshelper.com.au
2014-09-0314:05:32crammedia.com.au
2014-09-0314:05:32cramedia.com.au
2014-09-0314:05:324evermoreimages.com.au
2014-09-0314:05:32bravosurfsports.com.au
2014-09-0314:05:32marsdenproperty.com.au
2014-09-0314:05:32greekrecipes.com.au
2014-09-0314:05:32tagmyworld.com.au
2014-09-0314:05:37melbourneclinicalpsychology.net.au
2014-09-0314:05:37tagmyworld.net.au
2014-09-0314:15:33quickdollars.com.au
2014-09-0314:15:33alliedwebdesigns.com.au
2014-09-0314:15:33thearomaticdispensary.com.au
2014-09-0314:15:33heygelwarehouse.com.au
2014-09-0314:15:33aromaticdispensary.com.au
2014-09-0314:15:33derbyfreshmeat.com.au
2014-09-0314:15:33smokehealthy.com.au
2014-09-0314:15:33pashonista.com.au
2014-09-0314:15:33naturaltreazure.com.au
2014-09-0314:15:33dontforgettravelinsurance.com.au
2014-09-0314:15:34thewalkofshame.com.au
2014-09-0314:15:40aromaticdispensary.net.au
2014-09-0314:15:40dontforgettravelinsurance.net.au
2014-09-0314:15:40quickdollars.net.au
2014-09-0314:15:40thearomaticdispensary.net.au
2014-09-0314:15:40alliedwebdesigns.net.au
2014-09-0314:15:40aeh.net.au
2014-09-0314:30:18gracemedicalcenter.com.au
2014-09-0314:30:18kazakhstanpotashcorp.com.au
2014-09-0314:30:18zoofitness.com.au
2014-09-0314:30:18kati-thandra.com.au
2014-09-0314:30:18piphunting.com.au
2014-09-0314:30:18moviebites.com.au
2014-09-0314:30:18lordandmiddleton.com.au
2014-09-0314:30:18adbump.com.au
2014-09-0314:30:18kazakhstanpotashcorporation.com.au
2014-09-0314:30:18mariefranceaustralia.com.au
2014-09-0314:30:19soilstabilizers.com.au
2014-09-0314:30:19soilstabilizer.com.au
2014-09-0314:30:19ezyad.com.au
2014-09-0314:30:19incineratingtoiletsaustralia.com.au
2014-09-0314:30:24lordandmiddleton.net.au
2014-09-0314:30:24kati-thandra.net.au
2014-09-0314:30:24mariefranceaustralia.net.au
2014-09-0314:30:24caboodl.net.au
2014-09-0314:30:24freewifi.net.au
2014-09-0314:30:25kempseynsw.net.au
2014-09-0314:45:31mynrlcoach.com.au
2014-09-0314:45:31haulroadmanagement.com.au
2014-09-0314:45:31caboodl.com.au
2014-09-0314:45:31easypetboarding.com.au
2014-09-0314:45:31geostabilizers.com.au
2014-09-0314:45:31dustcontrolsolutions.com.au
2014-09-0314:45:31mysportscoach.com.au
2014-09-0314:45:31landscapearchitectsnorthernbeaches.com.au
2014-09-0314:45:31mybasketballcoach.com.au
2014-09-0314:45:31cirquedusoleilmovie.com.au
2014-09-0314:45:31printrbot.com.au
2014-09-0314:45:31lovemyswimming.com.au
2014-09-0314:45:31lovemyrunning.com.au
2014-09-0314:45:31pit2portsolutions.com.au
2014-09-0314:45:31landscapearchitectslowernorthshore.com.au
2014-09-0314:45:31haulroaddesigns.com.au
2014-09-0314:45:31lovemytriathlon.com.au
2014-09-0314:45:32findyourevent.com.au
2014-09-0314:45:32geostabiliser.com.au
2014-09-0314:45:32haulroads.com.au
2014-09-0314:45:32myaflcoach.com.au
2014-09-0314:45:32mynetballcoach.com.au
2014-09-0314:45:32elitegrowth.com.au
2014-09-0314:45:32rstinternational.com.au
2014-09-0314:45:32myrugbycoach.com.au
2014-09-0314:45:32geosorb.com.au
2014-09-0314:45:32mycricketcoach.com.au
2014-09-0314:45:32landscapearchitectshills.com.au
2014-09-0314:45:32seletterbox.com.au
2014-09-0314:45:32fastpetboarding.com.au
2014-09-0314:45:32tunnelguard.com.au
2014-09-0314:45:32myswimmingcoach.com.au
2014-09-0314:45:32instituteofdust.com.au
2014-09-0314:45:32fair-dinkum-roofing.com.au
2014-09-0314:45:32undae.com.au
2014-09-0314:45:32undaebeach.com.au
2014-09-0314:45:32lovemytri.com.au
2014-09-0314:45:32mypetrooms.com.au
2014-09-0314:45:32landscapearchitectsuppernorthshore.com.au
2014-09-0314:45:32mytenniscoach.com.au
2014-09-0314:45:32dustinstitute.com.au
2014-09-0314:45:32civilco.com.au
2014-09-0314:45:32rstdustearthwatersolutions.com.au
2014-09-0314:45:33econosavermarketing.com.au
2014-09-0314:45:33mysoccercoach.com.au
2014-09-0314:45:33myleaguecoach.com.au
2014-09-0314:45:33dusttech.com.au
2014-09-0314:45:33statusvision.com.au
2014-09-0314:45:33myhockeycoach.com.au
2014-09-0314:45:33geopolymer.com.au
2014-09-0314:45:33blastblanket.com.au
2014-09-0314:45:33sedibind.com.au
2014-09-0314:45:33internationalbusinessdirectltd.com.au
2014-09-0314:45:33geostabilisers.com.au
2014-09-0314:45:33myunioncoach.com.au
2014-09-0314:45:33dustech.com.au
2014-09-0314:45:33geosolution.com.au
2014-09-0314:55:32psychics-australia.com.au
2014-09-0314:55:32coffeecapsulepacking.com.au
2014-09-0314:55:32instituteofsoil.com.au
2014-09-0314:55:32soilinstitute.com.au
2014-09-0314:55:32yourtarget.com.au
2014-09-0314:55:32geobind.com.au
2014-09-0314:55:32outbackfilms.com.au
2014-09-0314:55:32newsbitesfinance.com.au
2014-09-0314:55:32preport.com.au
2014-09-0314:55:32electioncandidates.com.au
2014-09-0314:55:32togetherforscotty.com.au
2014-09-0314:55:32goflyaplane.com.au
2014-09-0314:55:32miningdust.com.au
2014-09-0314:55:33geostabilizer.com.au
2014-09-0314:55:33loft31.com.au
2014-09-0314:55:33myonlinesuccesscoach.com.au
2014-09-0314:55:33hanicourt.com.au
2014-09-0314:55:33theonepercentgroup.com.au
2014-09-0314:55:33damliner.com.au
2014-09-0314:55:38aceoconsulting.net.au
2014-09-0315:05:32safesounds.com.au
2014-09-0315:05:32poetic-licence.com.au
2014-09-0315:05:32eyebeautify.com.au
2014-09-0315:05:32speakout4kids.com.au
2014-09-0315:05:32realestatestationery.com.au
2014-09-0315:05:32apheliaskincare.com.au
2014-09-0315:05:32unrealestatefolders.com.au
2014-09-0315:05:33apojove.com.au
2014-09-0315:05:33pizzacatering2go.com.au
2014-09-0315:05:33valueus.com.au
2014-09-0315:05:33speakasone.com.au
2014-09-0315:05:33reeffestival.com.au
2014-09-0315:05:33cypherhealing.com.au
2014-09-0315:05:33fetchevents.com.au
2014-09-0315:05:33customkitchenandbathrooms.com.au
2014-09-0315:05:33qintessencecode.com.au
2014-09-0315:05:38geckoentertainment.net.au
2014-09-0315:15:32ohscentral.com.au
2014-09-0315:15:32mrbing.com.au
2014-09-0315:15:32bulletrainforcanberra.com.au
2014-09-0315:15:32cipherhealing.com.au
2014-09-0315:15:32yourproducer.com.au
2014-09-0315:15:32floralbunch.com.au
2014-09-0315:15:32software-solution.com.au
2014-09-0315:15:32stonebenchtopsperth.com.au
2014-09-0315:15:32demiurgic.com.au
2014-09-0315:15:32youronlinesuccessmentor.com.au
2014-09-0315:15:32quintessencecode.com.au
2014-09-0315:15:32buyabeat.com.au
2014-09-0315:15:32building4u.com.au
2014-09-0315:15:32crowntowersburswood.com.au
2014-09-0315:15:33gossage.com.au
2014-09-0315:15:33beatarmy.com.au
2014-09-0315:15:38foodcity.net.au
2014-09-0315:25:32caraccidentqld.com.au
2014-09-0315:25:32compensation-free-help.com.au
2014-09-0315:25:32photoboothsportstephens.com.au
2014-09-0315:25:32photoboothscesnock.com.au
2014-09-0315:25:32skibootstore.com.au
2014-09-0315:25:32photoboothsmuswellbrook.com.au
2014-09-0315:25:32inkpressions.com.au
2014-09-0315:25:32northaustralianbantenghunters.com.au
2014-09-0315:25:32photoboothslakemacquarie.com.au
2014-09-0315:25:32photoboothsnelsonbay.com.au
2014-09-0315:25:32caraccidentsydney.com.au
2014-09-0315:25:32r18games.com.au
2014-09-0315:25:32injuryhelpaustralia.com.au
2014-09-0315:25:32accidenttasmania.com.au
2014-09-0315:25:32uturndrivologyacademy.com.au
2014-09-0315:25:32compensationhelp.com.au
2014-09-0315:25:32freeaccidentcompensation.com.au
2014-09-0315:25:32mustengo.com.au
2014-09-0315:25:32weightshape.com.au
2014-09-0315:25:32venuehireinbrisbane.com.au
2014-09-0315:25:32balancedbias.com.au
2014-09-0315:25:33caraccidentnsw.com.au
2014-09-0315:25:33bestweddingreceptionvenues.com.au
2014-09-0315:25:33northaustralianbanteng.com.au
2014-09-0315:25:3324framesproductions.com.au
2014-09-0315:25:33photoboothsmaitland.com.au
2014-09-0315:25:33bondisportsclinic.com.au
2014-09-0315:25:33photoboothscentralcoast.com.au
2014-09-0315:25:33photoboothssingleton.com.au
2014-09-0315:25:33photoboothshuntervalley.com.au
2014-09-0315:25:38weightshape.net.au
2014-09-0315:35:31bestofalldeals.com.au
2014-09-0315:35:31carlaposenjak.com.au
2014-09-0315:35:31piig.com.au
2014-09-0315:35:31mmaoceania.com.au
2014-09-0315:35:31roof2000.com.au
2014-09-0315:35:31traceyheffernan.com.au
2014-09-0315:35:31avexcabinets.com.au
2014-09-0315:35:31jamieleighcarter.com.au
2014-09-0315:35:31sarahbright.com.au
2014-09-0315:35:312ndcycle.com.au
2014-09-0315:35:32legalinjuryhelp.com.au
2014-09-0315:35:32brilliantspeech.com.au
2014-09-0315:35:32building-renovation.com.au
2014-09-0315:35:32mygreenscapes.com.au
2014-09-0315:35:32bestofall.com.au
2014-09-0315:35:32aceventhire.com.au
2014-09-0315:35:32brilliantspeeches.com.au
2014-09-0315:35:32wesell4you.com.au
2014-09-0315:35:37wesellforyou.net.au
2014-09-0315:45:31qldpropertyforsale.com.au
2014-09-0315:45:31soapcove.com.au
2014-09-0315:45:31queenslandpropertyandrealestate.com.au
2014-09-0315:45:31lifespreciousmoments.com.au
2014-09-0315:45:31selectfitness.com.au
2014-09-0315:45:31preciousmomentsinlife.com.au
2014-09-0315:45:31easyseoservices.com.au
2014-09-0315:45:31aussieabcapp.com.au
2014-09-0315:45:31easylogodesign.com.au
2014-09-0315:45:31australianrealestatecompany.com.au
2014-09-0315:45:31cheapasboxes.com.au
2014-09-0315:45:31thecuverupman.com.au
2014-09-0315:45:31propertymaintenance-melbourne.com.au
2014-09-0315:55:31danahealth.com.au
2014-09-0315:55:31skysignage.com.au
2014-09-0315:55:31healthandwealth.com.au
2014-09-0315:55:31bmkmanagement.com.au
2014-09-0315:55:31cheapasbuckets.com.au
2014-09-0315:55:31workfromhomedads.com.au
2014-09-0315:55:31healthandfreedomsolution.com.au
2014-09-0315:55:31gooddeedcatcher.com.au
2014-09-0315:55:36healthandfreedom.net.au
2014-09-0315:55:36beegorgeous.net.au
2014-09-0316:05:31firstingolf.com.au
2014-09-0316:05:31foxtruckandplantsales.com.au
2014-09-0316:05:31scentofhome.com.au
2014-09-0316:05:32sfcaustralia.com.au
2014-09-0316:05:32approductions.com.au
2014-09-0316:05:32driveyrdream.com.au
2014-09-0316:05:32worldteccollege.com.au
2014-09-0316:05:32giveitbacktas.com.au
2014-09-0316:05:32ttha.com.au
2014-09-0316:05:32bigposters.com.au
2014-09-0316:05:32imperialglutenfree.com.au
2014-09-0316:05:32howtovoteforproperty.com.au
2014-09-0316:05:32coffeemachinesblog.com.au
2014-09-0316:05:32thecharlescollective.com.au
2014-09-0316:05:32mobilehairdressernorthernbeaches.com.au
2014-09-0316:05:32insightsecurityaustralia.com.au
2014-09-0316:05:32studentsforchrist.com.au
2014-09-0316:05:32leederrealestate.com.au
2014-09-0316:05:32brightoutlook.com.au
2014-09-0316:05:32ahintofchile.com.au
2014-09-0316:05:32treesavers.com.au
2014-09-0316:05:33brisbanewaxingmen.com.au
2014-09-0316:05:33smartcommute.com.au
2014-09-0316:05:331300bready.com.au
2014-09-0316:05:38smartcommute.net.au
2014-09-0316:05:38firstgolf.net.au
2014-09-0316:15:30sincerethanks.com.au
2014-09-0316:15:30baristapods.com.au
2014-09-0316:15:30netrevealed.com.au
2014-09-0316:15:31hairxtrordinar.com.au
2014-09-0316:15:31lakeeyrephotos.com.au
2014-09-0316:15:31queenofcatwalk.com.au
2014-09-0316:15:36sincerethanks.net.au
2014-09-0316:15:36passionateaboutproperty.net.au
2014-09-0316:35:31stonyoaks.com.au
2014-09-0317:35:30tamarakennedy.com.au
2014-09-0317:55:31imperialdroughtmasters.com.au

Deleted Domain Names

This list shows Domain Names which have been deleted at the request of either the Regulator based on established policy or the current Registrant. These Domain Names will purge at the next cycle that occurs NO EARLIER THAN the date and time listed below. Domain Names appearing on this list may be restored by the deleting party at any time up until they are purged and thus NOT become available for registration.

DateEligible Purge TimeDomain Name
2014-09-0203:17:04tcsau.com.au
2014-09-0203:18:41tcstrafficcalming.com.au
2014-09-0203:20:53trafficcalmingsolutionsoz.com.au
2014-09-0203:22:06rileykerb.com.au
2014-09-0203:55:28cogwheels.com.au
2014-09-0205:52:53wordpresslessons.com.au
2014-09-0208:05:46sportsdryneedling.com.au
2014-09-0208:05:46pagesforcolouring.com.au
2014-09-0210:07:02mrwebs.com.au
2014-09-0211:10:28darlingdownskids.com.au
2014-09-0211:20:12lmklawyer.com.au
2014-09-0222:00:10phillipturner.com.au
2014-09-0222:06:10dcruz.com.au
2014-09-0222:06:32delacruz.com.au
2014-09-0222:45:15greg.asn.au
2014-09-0222:45:38venicebeach.net.au
2014-09-0223:07:37summersaltphotography.com.au
2014-09-0223:07:43onthespotphotography.com.au
2014-09-0300:17:06macdonalds.com.au
2014-09-0300:49:51rosstools.net.au
2014-09-0301:16:07bestofmelbournetours.com.au
2014-09-0301:54:39taebootcamp.org.au
2014-09-0301:55:25hudsonstreet.org.au
2014-09-0301:57:21flavourart.org.au
2014-09-0301:59:23ezifengshui.org.au
2014-09-0302:01:04frost.org.au
2014-09-0302:02:27digitalspider.org.au
2014-09-0302:08:17cavalrycrete.com.au
2014-09-0302:08:34heart2heartfreedomzone.org.au
2014-09-0302:14:52realpersonals.org.au
2014-09-0302:17:51bizjapan.org.au
2014-09-0302:36:21australiatshirts.com.au
2014-09-0302:53:31belindaslade.com.au
2014-09-0304:06:51melbourneweightloss.com.au
2014-09-0304:43:47expresspartners.com.au
2014-09-0305:27:19mooreslights.com.au
2014-09-0305:52:06swedishwalking.com.au
2014-09-0307:54:17fireplace.org.au
2014-09-0308:18:31digilanti.net.au
2014-09-0312:06:06purpleninja.com.au
2014-09-0313:21:37esteem.com.au
2014-09-0314:06:19lgdg.com.au
2014-09-0316:20:15esotericteaching.com.au
2014-09-0320:31:03blackrivermovies.com.au
2014-09-0322:27:58when-someone-dies.com.au
2014-09-0322:31:34urbangrowsolutions.com.au
2014-09-0322:35:47closeyoureyes.com.au
2014-09-0322:54:57torchlightgroup.com.au
2014-09-0323:51:59realestate-warner.com.au
2014-09-0323:52:02realestate-eatonshill.com.au
2014-09-0323:52:03realestate-cashmere.com.au
2014-09-0323:52:05realestate-bridgemandowns.com.au
2014-09-0323:52:06realestate-albanycreek.com.au
2014-09-0400:07:30yourflexioffice.net.au
2014-09-0400:07:30yourflexioffice.com.au
2014-09-0400:09:12sushibibida.com.au
2014-09-0400:23:20optimumhealthchiropractic.com.au
2014-09-0400:45:01mjuniting.org.au
2014-09-0400:49:11itrecruit.com.au
2014-09-0400:57:22salvi.com.au
2014-09-0401:04:17adulttoyreview.com.au
2014-09-0401:13:55mathsheros.com.au
2014-09-0401:43:56learnfrom.com.au
2014-09-0402:16:01webdesignbyteengeek.com.au
2014-09-0402:24:11productreviewer.net.au
2014-09-0402:24:22productreview.org.au
2014-09-0402:29:42sydneyisdesign.com.au
2014-09-0402:30:18melbourneismusic.com.au
2014-09-0402:30:38sydneyisstyle.com.au
2014-09-0402:30:53sydneyisinteriordesign.com.au
2014-09-0402:31:10melbourneis.com.au
2014-09-0402:31:25melbourneisinteriordesign.com.au
2014-09-0402:31:54sydneyisfood.com.au
2014-09-0402:32:21sydneyismusic.com.au
2014-09-0402:32:58sydneyisculture.com.au
2014-09-0402:33:17sydneyis.com.au
2014-09-0402:33:34fnyum.com.au
2014-09-0402:33:51melbourneisculture.com.au
2014-09-0402:34:09freshnaturalyum.com.au
2014-09-0402:42:45mcalister.com.au
2014-09-0402:51:30anzinternetbanking.com.au
2014-09-0402:51:50westpaconlinebanking.com.au
2014-09-0402:58:43generalpracticejobs.com.au
2014-09-0402:58:56surgeryjobs.com.au
2014-09-0402:59:10internationaldoctors.com.au
2014-09-0403:06:32emergencelifecoaching.net.au
2014-09-0403:06:49emergencelifecoaching.com.au
2014-09-0403:45:30insuranceservices.com.au
2014-09-0404:32:08atasteofthetropics.com.au
2014-09-0405:06:11birthflower.com.au
2014-09-0407:16:14myfuturemyway.com.au
2014-09-0407:19:46snowcrow.com.au
2014-09-0407:36:11miningleases.com.au
2014-09-0407:37:33cakecrumbs.com.au
2014-09-0407:59:41camberwellrealestate.net.au
2014-09-0408:25:52bjscustomcabinets.com.au
2014-09-0409:08:42studyinfo.net.au
2014-09-0409:08:42studyinfo.com.au
2014-09-0409:45:33excelaccountants.com.au
2014-09-0409:47:21excelbookkeepers.com.au
2014-09-0409:47:53excelbook-keepers.com.au
2014-09-0409:54:42brisbane-websitedesign.com.au
2014-09-0409:55:04webdesign-sydney.net.au
2014-09-0409:56:07bondcleanersmelbourne.com.au
2014-09-0409:59:38seo-goldcoast.net.au
2014-09-0410:00:00seo-searchengineoptimisation.net.au
2014-09-0410:20:14margyfer.com.au
2014-09-0412:06:08electricalservicesmoonah.com.au
2014-09-0412:06:09electricalservicesmoontah.com.au
2014-09-0412:49:34swanelectrical.com.au
2014-09-0412:49:59swanrefrigeration.com.au
2014-09-0412:50:21swanfm.net.au
2014-09-0412:50:43swanit.net.au
2014-09-0412:51:02swanearthmoving.com.au
2014-09-0412:51:26swanbuilding.com.au
2014-09-0412:51:59swansecurity.com.au
2014-09-0413:58:51divadomains.com.au
2014-09-0413:59:41sleepdoctorwagga.com.au
2014-09-0416:42:17tedicore.org.au
2014-09-0416:55:12faaw.org.au
2014-09-0420:06:46booksnpayroll.com.au
2014-09-0421:43:59eswingers.net.au
2014-09-0421:44:33eswingers.com.au
2014-09-0500:39:07film120.com.au
2014-09-0500:51:23sportssimulatorbrisbane.com.au
2014-09-0500:52:12sportssimulatorhire.com.au
2014-09-0500:52:36sportssimulatorrental.com.au
2014-09-0501:20:50ex-government.com.au
2014-09-0501:49:40advancepenshurst.com.au
2014-09-0502:07:32gst-registration.com.au
2014-09-0502:11:28landesigns.net.au
2014-09-0502:11:59nataliesdesigns.com.au
2014-09-0502:12:16landesigns.com.au
2014-09-0502:20:10flyclub.com.au
2014-09-0503:29:10monstermilk.com.au
2014-09-0503:41:04customstampswa.com.au
2014-09-0504:17:42websitegenius.com.au
2014-09-0505:00:05thissportinglife.com.au
2014-09-0505:02:02landsdaleschoolofearlylearning.com.au
2014-09-0505:11:14lighteningelectrical.com.au
2014-09-0506:30:40nous.net.au
2014-09-0507:01:20herbalism.com.au
2014-09-0507:31:53viral-video-marketing.com.au
2014-09-0507:32:05viral-video-marketing.net.au
2014-09-0507:32:14corporate-videos-sydney.com.au
2014-09-0507:32:35seo-video-marketing.com.au
2014-09-0507:32:46seo-video-marketing.net.au
2014-09-0507:32:56videohdr.net.au
2014-09-0507:33:09videohdr.com.au
2014-09-0507:33:19hdrmotion.com.au
2014-09-0507:33:33motionhdr.com.au
2014-09-0507:33:43realestatehdr.com.au
2014-09-0507:34:02soldwithvideo.com.au
2014-09-0507:34:12timelapsevideos.com.au
2014-09-0507:34:24videomarketingsydney.com.au
2014-09-0507:35:24hdrvideo.com.au
2014-09-0507:36:04videoeditorsydney.com.au
2014-09-0507:59:57praisethelowered.com.au
2014-09-0508:18:52baysideretreat.com.au
2014-09-0509:12:48whiterabbitvintage.com.au
2014-09-0509:13:57queensparkjfc.com.au
2014-09-0509:47:11micommelectrical.com.au
2014-09-0510:07:21healthiercoffee.com.au
2014-09-0510:08:06capwerxprojects.com.au
2014-09-0513:23:15bodifitness.com.au
2014-09-0513:23:42absolutehealthandfitness.com.au
2014-09-0513:24:19absolutefitnesstraining.com.au
2014-09-0513:24:46absolutefitnesspt.com.au
2014-09-0802:19:18patentattorney.org.au
2014-09-0818:08:10etax-lodge.com.au
2014-09-1002:56:21wineshow.org.au
2014-09-1005:45:31silentsuffering.org.au
2014-09-1005:52:00billfingerwatertechnologies.org.au
2014-09-1005:58:16cyplus.org.au
2014-09-1006:01:23i4animals.org.au
2014-09-1006:06:54rotork.org.au
2014-09-1006:09:07sawtell.org.au
2014-09-1006:10:45sharkwatch.org.au
2014-09-1006:11:45sportrelief.org.au
2014-09-1006:30:21transfarmers.org.au
2014-09-1006:31:50wildlifevet.org.au
2014-09-1023:41:05ourchildrenaustralia.org.au
2014-09-1023:53:51highperformingworkplace.org.au
2014-09-1023:55:45hes.org.au
2014-09-1201:44:48wireless.asn.au
2014-09-1502:09:10realest.com.au
2014-09-1502:11:44betbank.com.au
2014-09-1503:28:22pxtas.org.au
2014-09-1515:00:46tees.org.au
2014-09-1604:39:52training.asn.au
2014-09-1605:35:09ugg.org.au
2014-09-1605:36:21rapidspraybarn.org.au
2014-09-1605:37:56rapidsprayshop.org.au
2014-09-1606:19:02rapidspray.org.au
2014-09-1606:21:29healthy-snacks.org.au
2014-09-1606:27:09botanicflowers.org.au
2014-09-1606:29:44retailhealthcheck.org.au
2014-09-1606:32:01teca.org.au
2014-09-1606:36:03meu.org.au
2014-09-1606:46:24gncc.org.au
2014-09-1606:53:01ecmonet.org.au
2014-09-1606:53:22brisk.org.au
2014-09-1606:56:06engagementringssydney.org.au
2014-09-1606:58:06inviziq.org.au

Check Availability

Please enter your desired .au Domain Name below:

Click here for .edu.au and .gov.au Domains

Find a Registrar

goRegister a .au Domain Name from the list of 40 auDA Accredited Registrars

Scheduled Maintenance